KEGG   Capra hircus (goat): 102170766
Entry
102170766         CDS       T02910                                 

Gene name
PIM2
Definition
(RefSeq) Pim-2 proto-oncogene, serine/threonine kinase
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx05200  Pathways in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102170766 (PIM2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102170766 (PIM2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102170766 (PIM2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   102170766 (PIM2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 102170766
NCBI-ProteinID: XP_005700821
UniProt: A0A452E4Y2
LinkDB
Position
Un
AA seq 311 aa
MLTKPLQGLPVAPMTPTPLPGGKDREAFEAEYQLGPLLGKGGFGTVFAGHRVTDRLQVAI
KVIPRNRVLGWSPLSDSVACPLEVALLWKVGAGGGHPGVIRLLDWFETPEGFMLVLERPL
PAQDLFDYITEQGPLGEGRSRCLFAQVVAAVRHCHARGVVHRDIKDENILMDLRRGCTKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSARPSLEEILLDPWMQTPAEDASLNTPKG
GPTPLDWSLLP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgttgactaagcctctgcaggggctcccggtggcccccatgactcctacgccgctgcca
ggaggcaaggatcgggaagcgttcgaggccgagtaccaacttggccccctcctcggcaag
gggggctttggcaccgtcttcgcaggacatcgcgtcacagaccgactccaggtggccatc
aaagtgatcccccggaatcgcgtgctgggctggtcccccttgtcagactcagtcgcatgc
ccactggaagtggcactgctatggaaggtgggtgcaggcggtgggcaccctggtgtgatc
cgcctgcttgactggtttgagacaccagagggcttcatgctggtccttgagcggcctctg
cctgcccaggatctctttgactacatcacagagcaaggcccattgggtgaaggccgaagc
cgctgtctctttgcccaggtagtggcagctgttcggcactgccacgcccgtggagttgtc
catcgtgacatcaaggatgagaacatcctgatggacctccgccggggctgtaccaaactc
attgattttggttctggtgccctgcttcatgatgaaccctatactgactttgatgggaca
agggtgtacagtcccccagagtggatctctcgtcaccagtaccacgccctgccagccact
gtctggtcactgggtatcctcctctatgacatggtatgtggggacattccctttgagaga
gaccaggagattctggaggctgaactccacttccctgcccatgtctccccagattgttgt
gccctaatccgccggtgcctggcccccaaaccctctgcccgaccctcactggaggagatc
ctgctggacccctggatgcagacaccagctgaggatgcatccctcaacactcccaaaggg
ggtcccacccctttggactggtccctactgccctag

DBGET integrated database retrieval system