KEGG   Capra hircus (goat): 102170985
Entry
102170985         CDS       T02910                                 

Gene name
PPP1CB
Definition
(RefSeq) protein phosphatase 1 catalytic subunit beta
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx03015  mRNA surveillance pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04720  Long-term potentiation
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04921  Oxytocin signaling pathway
chx04931  Insulin resistance
chx05031  Amphetamine addiction
chx05034  Alcoholism
chx05168  Herpes simplex virus 1 infection
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102170985 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102170985 (PPP1CB)
   04024 cAMP signaling pathway
    102170985 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    102170985 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102170985 (PPP1CB)
   04218 Cellular senescence
    102170985 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102170985 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102170985 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102170985 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102170985 (PPP1CB)
   04921 Oxytocin signaling pathway
    102170985 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102170985 (PPP1CB)
   04270 Vascular smooth muscle contraction
    102170985 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    102170985 (PPP1CB)
   04720 Long-term potentiation
    102170985 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102170985 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102170985 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102170985 (PPP1CB)
   05034 Alcoholism
    102170985 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102170985 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102170985 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102170985 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:chx03021]
    102170985 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:chx03019]
    102170985 (PPP1CB)
   03041 Spliceosome [BR:chx03041]
    102170985 (PPP1CB)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102170985 (PPP1CB)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     102170985 (PPP1CB)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     102170985 (PPP1CB)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     102170985 (PPP1CB)
Spliceosome [BR:chx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    102170985 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 102170985
NCBI-ProteinID: XP_017910974
UniProt: A0A452EJ96
LinkDB
Position
11
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagccttattacccgactgctggaggtacgagga
tgtcgtccaggaaagatcgtacagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcaccactgaaaatc
tgtggagatattcatggacagtatacagatttactgcgattatttgaatatgggggtttc
cccccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaacaatctgcttgctattggcatataaaatcaaatacccagaaaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaagatttaatattaagttgtggaagaccttcactgactgtttcaactgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacctgcaa
tctatggagcagatacggagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttgctgtggtctgacccagataaggatgtgcaagggtggggagaaaatgatcgt
ggtgtttccttcacttttggagctgacgtagtcagtaaatttctgaatcggcatgattta
gacttgatttgtcgagctcatcaggttgtggaagatggatatgaattctttgctaagcga
caactggtaaccctgttttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccgtctgaaaag
aaagctaagtaccaatatggtggactgaattcaggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Capra hircus (goat): 102181064
Entry
102181064         CDS       T02910                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx03015  mRNA surveillance pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04720  Long-term potentiation
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04921  Oxytocin signaling pathway
chx04931  Insulin resistance
chx05031  Amphetamine addiction
chx05034  Alcoholism
chx05168  Herpes simplex virus 1 infection
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102181064 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102181064 (PPP1CC)
   04024 cAMP signaling pathway
    102181064 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    102181064 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102181064 (PPP1CC)
   04218 Cellular senescence
    102181064 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181064 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181064 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181064 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102181064 (PPP1CC)
   04921 Oxytocin signaling pathway
    102181064 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102181064 (PPP1CC)
   04270 Vascular smooth muscle contraction
    102181064 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    102181064 (PPP1CC)
   04720 Long-term potentiation
    102181064 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102181064 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102181064 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    102181064 (PPP1CC)
   05034 Alcoholism
    102181064 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102181064 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102181064 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102181064 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:chx03021]
    102181064 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:chx03019]
    102181064 (PPP1CC)
   03041 Spliceosome [BR:chx03041]
    102181064 (PPP1CC)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102181064 (PPP1CC)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     102181064 (PPP1CC)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     102181064 (PPP1CC)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     102181064 (PPP1CC)
Spliceosome [BR:chx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    102181064 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 102181064
NCBI-ProteinID: XP_017916745
LinkDB
Position
17
AA seq 337 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVTSGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcggatatagataaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatcagaggactgtgctta
aagtcccgagagatctttctcagtcagcctatcctgctagaacttgaagcaccactcaag
atatgtggtgatatccatgggcaatactatgatttgcttcgactttttgagtatggtggt
ttcccgccagaaagcaattacctgtttcttggggactatgtggacaggggaaaacaatca
ctggagactatctgcctcttgttggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccacgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaactgtttaccg
atagcagccatcgtggatgagaaaatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccgaatgccacaagacccgtcacacctccaagggttacatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

KEGG   Capra hircus (goat): 102181571
Entry
102181571         CDS       T02910                                 

Gene name
PPP1CA
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx03015  mRNA surveillance pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04611  Platelet activation
chx04720  Long-term potentiation
chx04728  Dopaminergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04921  Oxytocin signaling pathway
chx04931  Insulin resistance
chx05031  Amphetamine addiction
chx05034  Alcoholism
chx05168  Herpes simplex virus 1 infection
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    102181571 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102181571 (PPP1CA)
   04024 cAMP signaling pathway
    102181571 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    102181571 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102181571 (PPP1CA)
   04218 Cellular senescence
    102181571 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181571 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181571 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181571 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102181571 (PPP1CA)
   04921 Oxytocin signaling pathway
    102181571 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102181571 (PPP1CA)
   04270 Vascular smooth muscle contraction
    102181571 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    102181571 (PPP1CA)
   04720 Long-term potentiation
    102181571 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102181571 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102181571 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102181571 (PPP1CA)
   05034 Alcoholism
    102181571 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102181571 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102181571 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102181571 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:chx03021]
    102181571 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:chx03019]
    102181571 (PPP1CA)
   03041 Spliceosome [BR:chx03041]
    102181571 (PPP1CA)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102181571 (PPP1CA)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     102181571 (PPP1CA)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     102181571 (PPP1CA)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     102181571 (PPP1CA)
Spliceosome [BR:chx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    102181571 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 102181571
NCBI-ProteinID: XP_017898883
UniProt: A0A452EER0
LinkDB
Position
29
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctataatcggacgcctgctggaagtgcag
ggctccaggcctggaaagaatgtacagctgacagagaacgagatccgtggtctgtgcctc
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgcggtgacattcacggccagtactatgaccttctgcggctgtttgagtacggcggc
ttccctccagagagtaactacctgttcctgggggactacgtggacaggggcaagcagtct
ttggagaccatctgcctgctgctggcctataagatcaagtacccggagaacttcttcctg
ctccgtgggaaccacgagtgtgccagtatcaaccgcatctatggcttctatgatgagtgc
aagagacgctacaacatcaaactgtggaagaccttcactgattgcttcaactgcctgccc
atcgctgccatcgtggacgagaagatcttctgttgccatggaggcctgtccccagaccta
cagtccatggagcagatccggcgcatcatgcggcccacagatgtgcctgaccagggcctg
ctctgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgcggcgtctcctttacctttggagctgaggtggtggccaagttcctgcacaagcatgac
ctggacctcatctgccgggcacaccaggtagtagaagatggctacgagttctttgccaag
cggcagctggtgacactcttctcagcccccaactactgcggcgagtttgacaatgcaggt
gccatgatgagcgtggacgagacactcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaaatacgggcagttcagtggcctgaaccctggaggccggcccatcacc
ccaccccgcaactccgccaaagccaagaaatag

KEGG   Capra hircus (goat): 102181773
Entry
102181773         CDS       T02910                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
chx  Capra hircus (goat)
Pathway
chx04270  Vascular smooth muscle contraction
chx04510  Focal adhesion
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181773 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181773 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181773 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102181773 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102181773 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102181773 (PPP1R12B)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102181773 (PPP1R12B)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 PRKG1_interact Ank Ank_3 MEDS
Other DBs
NCBI-GeneID: 102181773
NCBI-ProteinID: XP_017916339
LinkDB
Position
16
AA seq 999 aa
MAELEHLGGKRAESARARRAEQLRRWRGSPTEQEPADRPGAGPQARRGGPRVRFEDGAVF
LAACSSGDTDEVRRLLARGADVDTANVDGLTALHQACIDENLDVVKFLVENGASVNQQDN
EGWTPLHAAASCGYLNIAEYFINHGACVGIVNNEGEVPSDLAEEPAMKDLLLEQVKKQGL
DLEQARRQEEQQMLQDARQWLNSGRIADVRQARSGATALHVAAAKGYSEVLRLLIQAGYE
LNVQDHDGWTPLHAAAHWGVKEACSILAEALCDMDVRSKLGQTPFDVADEGLAEHLEALQ
KRQGVLRSEKETRDKLIESDLNSELHSRLFKNKEKMLCEEETPKSQRAEEESKESSSSSS
EEDEGEDEASESEAEKEAGDPEAVRPQSMGGRRVSEGGGPGAVPSRPSSDCRSSVAERTP
AAPQSAVPASAARRPSSLFSKPEETRDESPCSWRLGLRKTGSQNVLSEAAGAREALRDRG
ASVHRSASSPRISTLTDSREKEREARSSSSSLGLRRPGSTSDLEEKENRESAANLVCSGS
QPRQPWRDAAKGSEAPQTAAPSTYVSTFLKRTPHRSQADSTAERADGIACSSPLCVITNR
PPPSTVRGAPAAAPLCAPGPEPSAEAGQRRRSYLTPVRDEEAESLRRARSRQARQTRRST
QGVTLTDLQEAERTFSRSRVEHQAQEQPSLKPVGPGVLEGGPRKHEPLAAPAQEAGESHQ
PWGRSPEGERPGQPEQPTAPASPSAPRPSLYTSSYLLRTGGSSAPAAQSSEPPAGTPGTR
DMDRNEGGEAEPGDQSSGRMSVRERRRPRERRRGTGINFWTKDEDETEVPEEVKKAWRER
LSRLESGGSDASTERASARARREAREARLATLSSRAEEDGGRGYRKLYESALTENQKLKT
KLQEAQLELADVKSRLEKMAQKQDKTPDRSSALETEKRERRALERKMSEMEEEVKNLHQL
KQIQTLKHVNEQLQAENRALTRVVARLSEAVEGSDPQGP
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggccgagctggagcacttgggcgggaagcgggctgagtcggcgcgggcgcggcgggcc
gagcagctgcggcgctggcggggctcgccgactgagcaggagcccgctgaccggccgggc
gcggggccgcaggctcggcgcgggggcccgcgggtccgcttcgaggacggcgctgtgttc
ctggccgcctgctccagcggggacaccgacgaagtgaggcggctcctggcccggggcgcc
gacgtggacacggccaacgtggacggcctgaccgcgctgcaccaggcctgcatcgacgag
aacctggatgtggtgaagtttctggtggagaacggagccagcgtcaaccagcaggacaac
gagggctggacgcccctgcacgcggcagcgtcctgtggctacctcaacatagcagagtat
ttcattaaccatggagcctgcgtgggcatcgtcaacaacgaaggcgaagtcccctctgac
cttgcggaagagcctgccatgaaggaccttcttctggagcaggtgaagaagcaagggctg
gacctcgagcaggcgcggcggcaggaggaacagcagatgctgcaggacgcccgccagtgg
ctcaacagcggcaggatcgccgacgtgaggcaggcgcgctcgggggccactgccctgcac
gtggctgcggccaagggctactccgaggtcctcagacttttgattcaggctggctatgag
ctcaatgtccaggaccacgacggctggacccctctgcacgcggctgcgcactggggcgtg
aaggaggcctgctccatcctggcagaggccctctgcgacatggatgtcaggagcaagctg
ggccagacgccgttcgacgtggctgacgagggcctggcggagcacctggaggcgctgcag
aagaggcagggcgtgcttcgaagtgaaaaagagacacgggataagctcatcgaatcagac
ctgaacagcgagctgcacagtagactcttcaagaacaaagagaagatgctctgtgaggag
gagacgcccaagtcccagcgagcagaggaggagagcaaagagtccagcagctccagctcc
gaggaggatgagggggaggacgaggcctcggagtcagaggccgagaaggaggcgggggac
cctgaggccgtccgtccgcagagcatggggggccgccgcgtgtcagaaggtggcgggccg
ggcgccgtccccagccgtcccagctctgactgcaggagcagcgtcgcggagcggaccccc
gcagcgccgcagagcgccgtccccgcctctgcagccaggagaccctccagcctcttcagc
aagccggaagagaccagggacgagtctccatgttcgtggaggctgggcctcaggaagacc
ggcagccagaatgtgctgagtgaggccgccggggccagggaggccctgcgggaccggggc
gcgtctgtccaccgctcggcctccagcccccgcatctccacgctgacggacagcagagaa
aaggagagagaagccagaagctcctcgagttcactggggctgcggaggccgggcagcact
agcgaccttgaagagaaggagaacagagagtcggctgctaacctggtgtgcagtggctcc
cagccccggcagccctggagggacgcagccaaggggagcgaggccccgcagacggccgct
ccctccacctacgtgtcgaccttcctgaaaaggacccctcacaggtcccaggccgactcc
acggcagagagagccgacggcatcgcctgcagcagcccgctctgtgtgatcacgaaccgc
cccccgcccagcactgtccgcggggctccagctgccgcgccgctctgcgcccctggccct
gagccctctgcggaagccgggcagaggaggaggtcgtatctgactcctgtccgggacgag
gaagcagagtccttacggagggcacgctccaggcaggctcggcagactcgaaggtctacc
caaggcgtcaccctcacggaccttcaggaagcggagaggacgttcagccggtcgagggta
gagcatcaggctcaggagcagcccagcctgaagcccgtgggtcccggagtacttgagggc
ggcccccggaagcacgagcccttggcggcccctgcccaggaagccggggagagccaccag
ccctggggccggagcccggagggagagcgtccaggtcagcccgagcagcccacggcgccg
gcgtccccttccgccccgagaccctcgctctacaccagctcctacctgctccggacgggt
gggtcctctgcacctgccgcccagagctcagagccccccgcaggcactcccgggacgcgg
gacatggacagaaacgagggcggagaagcagagccgggcgaccagtcctccggcaggatg
tccgtccgagagaggaggcggccccgggagcgccggcggggcacgggcatcaacttctgg
acgaaggacgaagatgaaacggaagtcccggaagaggtgaagaaagcgtggcgtgagcga
ctctccaggctggaatctggaggcagcgacgcgtccactgagcgggcctcagccagagcc
cgccgggaggcccgcgaggcccgcctggccaccctgagcagccgcgcggaggaggacggc
ggcaggggctacaggaagctctacgagagcgccctgaccgagaaccagaagctgaagaca
aaacttcaggaggcccagctcgagctggcggacgtgaagtccaggcttgagaagatggcc
cagaagcaagacaagacaccggaccggtcgtcggccctggagacggagaagagggagagg
cgggccctggagcggaagatgtcggagatggaagaggaagtgaagaaccttcaccagcta
aaacagattcagaccttgaagcacgtgaacgagcagctgcaggctgagaaccgggctctg
acccgggttgtggccagactctcggaggccgtcgagggctcggacccccaggggccctag

KEGG   Capra hircus (goat): 102183294
Entry
102183294         CDS       T02910                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04270  Vascular smooth muscle contraction
chx04510  Focal adhesion
chx04611  Platelet activation
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102183294 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    102183294 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102183294 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102183294 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102183294 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102183294 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102183294 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102183294 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102183294 (PPP1R12A)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102183294 (PPP1R12A)
SSDB
Motif
Pfam: Ank_4 Ank_2 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 102183294
NCBI-ProteinID: XP_017903084
UniProt: A0A452DU89
LinkDB
Position
5
AA seq 1029 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHISDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKREKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDDEEEGKKDESSCSSEEE
EEDDSESEAETDKTTKPMASVTNANTSSTQAAPVAVTTPTVSSGQPTPTSPIKKFPTSAT
KISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVMRSASSPRLSSS
LDNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKK
NSSINEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTG
SSSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSST
AEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRT
REQENEEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTPS
SLLSTMSSSLYASSQLNRPNSLVGITSAYSRGLTKENEREGEKKEEEKEGEDKSQPKSIR
ERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKEVQTDSISRYEVSSTSASDRY
DSLLGRSGSYSYSEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLK
LQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGAL
IRVISKLSK
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcctgtggtgaagcgccagaagaccaaggtgaagttcgatgat
ggcgccgtcttcctggctgcttgctccagcggcgacacggacgaggttctcaagctgctg
caccgcggcgccgacatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcgaatattaac
caacctgataatgaaggctggatacctctgcatgcagctgcttcttgtggatacctcgac
attgcagagtttttgattggtcagggagcacatgtaggagctgtcaacagtgaaggagac
acacctttagatattgctgaggaggaggcaatggaagagctacttcagaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaagaagaggaacgaataatgcttcgagat
gcccgacagtggttaaatagtggccatataagtgacgtccggcacgcaaagtctggaggc
acagcgcttcacgtcgcagccgccaagggctatacagaagttttaaaacttttaatacag
gcaggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcggattttagtggacaatctatgtgatatggagatg
gtcaacaaagtgggccagacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttacaaaagaaacaaaatctgctccatagtgaaaaacgggaaaagaaatctcca
ctaattgaatcaacagctaatatggataataatcagtcacagaagacctttaaaaataaa
gagacattgattattgagcctgagaaaaatgcatcccgtattgaatctctggaacaagaa
aaggttgatgatgaagaagaaggaaagaaagatgaatctagttgctctagtgaagaagaa
gaggaagatgactcagaatcagaagctgaaacagataagacaacaaaacccatggcttct
gtaactaatgccaatacttctagtacacaagcagctcctgtagctgttacaacacctact
gtgtcatctggtcagccaacacctacatcacctattaaaaagtttccaacttcagctaca
aaaatttctcccaaagaagaagagagaaaagatgagtcccctgcatcttggaggttagga
cttagaaagacgggcagttacggcgcacttgcagaaatcacagcatctaaagaagctcag
aaggaaaaagacactgcaggtgtcatgcgctcagcttcaagtcccaggctttcctcctct
ttggataataaagaaaaggaaaaagatagtaaaggaactaggcttgcatatgttgcgcct
acaataccaagacggctcgccagtacatctgacattgaagagaaagagaacagagattct
tcaagtttgcgaacaagtagttcatatacaagaagaaaatgggaagatgatcttaaaaag
aatagctcaattaatgaaggatcaacttatcacaaaagttgctcctttggtagaagacaa
gatgatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgca
gctgggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggt
tcttcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtact
gaaaaggaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtt
aatgctgcagcctctaccacaaccctgactacaactactgctggcactgtctcctccact
gcagaggtcagggagagacgcagatcatacctcactcctgttagagatgaagagtctgaa
tcccaaagaaaagcaagatctagacaagcaaggcagtctagaagatcaacacagggggta
acattgactgatcttcaggaagctgaaaaaacaatagggaggagtcgttccacccgaacc
agagaacaagaaaatgaagaaaaagaggaaaaagagaaacaggataaagaaaagcaggaa
gaaaagaaggaatcagaaacatctagagaagatgaatataaacaaaagtactccagaaca
tatgatgagacttatcaacgctacagaccagtatcaacttcaagttcaaccactccctcc
tctttactttctacaatgagcagttcactttatgcttcaagtcagttaaacaggccaaac
agtcttgtaggtataacttctgcttactccagaggattaacaaaggaaaatgaaagagag
ggagaaaagaaagaagaagaaaaagagggggaagataaatcccaacctaaatcaatcaga
gaacgaaggcgaccgagagagaagagaagatctacaggagtttcgttttggacacaagat
agtgatgaaaatgaacaagaacaacaatctgatacagaggagggatccaataagaaagaa
gttcagacggattccatttctagatatgaagtcagttctacatcagctagtgatcggtat
gattccttgctgggtcgctctggatcatacagttactcagaagaaagaaaaccttacagt
agcaggctagaaaaggatgattcaactgactttaaaaagctttatgaacaaattctagct
gaaaatgaaaagctgaaagcacagctacatgatacaaatatggaactgacagatcttaaa
ttacaattggaaaaagccacccagagacaagaaagatttgctgataggtcactgttagaa
atggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagagctg
aaaatgttaccagacctgaaagcggacaaccagaggctaaaagatgaaaatggggccttg
atcagagttataagcaaactttccaaataa

KEGG   Capra hircus (goat): 102187707
Entry
102187707         CDS       T02910                                 

Gene name
PPP1R12C
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
chx  Capra hircus (goat)
Pathway
chx04270  Vascular smooth muscle contraction
chx04510  Focal adhesion
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102187707 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102187707 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102187707 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102187707 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102187707 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102187707 (PPP1R12C)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102187707 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 102187707
NCBI-ProteinID: XP_017918591
UniProt: A0A452F158
LinkDB
Position
18
AA seq 782 aa
MSGEDGPGAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
ALLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELAQKQEDLRNQKEAAQSRGPESQGPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGTPIRDEDEGEEAPSEPPPAECRALNGVSSPPPCSPGSPVTPEEAPFSRRF
GLQKTGSSGALGPADWRGAEGAPGAGLQRSASSSRLEGASTQGREPRLARVPPTPSQKVP
EPSSPSEISRPPPPLGNSTPHPRTPEPESPVKPHVPVASAAPPADSRDRRRTYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPDAEKSSVQSLDTSRRPRVPGV
ESTDGPAQRAEAPDGQGQGPQAAREPRRVGKEWRGPAEGEEAEPAQADRSPESSTPEGDP
SSRRQRDLNADPEPEPDEPDEGFRKLYAELRSENERLREALTETTLQLAQLKVDLERATQ
KQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtcgggcgaggacggccccggggcgggccccggggcggcggcagcagcggcccgcgag
cggcggcgggagcagctgcggcagtggggggctcgggcgggcgccgagccgggccccggg
gagcggcgcgcccgcaccgtgcgcttcgagcgcgccgccgagttcctggcggcctgcgcg
ggcggcgacctggacgaggcgcgcctgatgctgcgcgcggccgaccccggccccggcgca
gagctggaccccgccgccccgccgcccgcccgcgccgtgctcgactccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcattgacgagaaccttgaggtggtgcgcttcctg
gtggagcagggtgccacagtgaaccaggcggacaacgagggctggacgcccctccacgtg
gccgcctcctgcggttacctggacatcgccaggtacctcctgagccatggggccaacatc
gctgcggtcaacagcgacggggacctgcctctggacctggccgagtccgacgccatggag
gcgctgctgaaggcggagatcgcccgccgaggtgtggacgtggaggcagccaaacgggcg
gaggaggaattgctgcttcacgacacaaggtgctggctgaatgggggcgccatgcccgag
gcgcggcacccccgcacgggcgcctctgccctgcacgtggctgccgccaagggttacatc
gaagtgatgaggctgctcctccaggctggctacgacccggagctgcgtgacggcgacggc
tggacgcccctgcatgccgcggcccactggggtgtggaggatgcctgccgcctgctggcg
gagcacggcgggggcatggactcgctgacccacgcggggcagcgtccctgtgacctggcg
gacgaggaggtgctgagcctgctggaggaactggcccagaagcaggaggaccttcggaac
caaaaggaagctgcccagagccggggcccggagtcgcaggggccctccagcagcaaacat
cgaaggagctccgtgtgccgtctgagcagccgcgagaagatctccctccaagacctgtcc
aaggagcgccggcccgggggtgcagggggcacccccatccgggacgaggacgagggagaa
gaagccccctcagagccaccccctgccgaatgcagagccctcaacggggtctcctccccg
ccgccctgtagccctgggagccccgtgacccccgaggaggcccccttctccaggcgcttt
ggcctccagaagacaggcagctccggggctctgggacccgcggactggcgcggagccgag
ggcgctccgggggccgggctgcagcgctccgcgtcctcctcgcggctggagggtgcatcc
actcagggccgggagccccgtcttgccagagtcccccccaccccctcccagaaggtgccg
gagccctcttccccgtctgagatctccaggcctcctcctcccttgggtaactccactcct
caccccaggacccccgagcccgagtccccggtgaagccccatgtccccgtagcctccgca
gcgcccccagcggactcccgggaccgccggaggacctaccagatgccagtgcgggacgag
gagtctgagtctcagcggaaagcgcgctctcgcctcatgcgccagtcccggaggtccacg
cagggtgtgaccctgacggacctgaaggaagcagagaaggccgctggaaaggccccggat
gcagagaagtcgagcgtgcagagcctggacacttcccggagaccccgagtccctggggtc
gagagcactgacggccctgcccagagagcagaggcgcccgacgggcaagggcaggggccg
caggcggccagggagccccgcagagtcggcaaggagtggaggggccctgccgagggggag
gaggcggagccagcgcaagccgaccgcagcccagaatccagcactcccgagggcgacccc
tcatcccgcaggcagcgggatctcaacgcagacccagagccggaaccggacgagccggac
gaaggcttcaggaagctgtacgccgagctgcgcagtgagaacgagcgccttcgcgaggcc
ctgacggagaccaccctgcagctggcgcagctcaaggtggacctggagcgcgccactcag
aagcaggagcgctttgcagagaggcctgcccttctggagctggagagattcgagcgcagg
gccctggagcgaaaggcagccgaactggaggaggagctgaaggccctgtccgaccttcgg
gctgacaaccagcggctcaaggatgagaacgcagccctgattcgtgtcatcagcaaactc
tccaagtga

DBGET integrated database retrieval system