KEGG   Capra hircus (goat): 102171022
Entry
102171022         CDS       T02910                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04071  Sphingolipid signaling pathway
chx04270  Vascular smooth muscle contraction
chx04350  TGF-beta signaling pathway
chx04360  Axon guidance
chx04510  Focal adhesion
chx04530  Tight junction
chx04611  Platelet activation
chx04670  Leukocyte transendothelial migration
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx05135  Yersinia infection
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102171022 (ROCK1)
   04071 Sphingolipid signaling pathway
    102171022 (ROCK1)
   04024 cAMP signaling pathway
    102171022 (ROCK1)
   04022 cGMP-PKG signaling pathway
    102171022 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102171022 (ROCK1)
   04530 Tight junction
    102171022 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102171022 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102171022 (ROCK1)
   04670 Leukocyte transendothelial migration
    102171022 (ROCK1)
   04062 Chemokine signaling pathway
    102171022 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102171022 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102171022 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    102171022 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102171022 (ROCK1)
   05206 MicroRNAs in cancer
    102171022 (ROCK1)
   05205 Proteoglycans in cancer
    102171022 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102171022 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102171022 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102171022 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102171022 (ROCK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102171022 (ROCK1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   102171022 (ROCK1)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102171022 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH Cortex-I_coil C1_1 APH Pkinase_C YHYH
Other DBs
NCBI-GeneID: 102171022
NCBI-ProteinID: XP_005697117
UniProt: A0A452EUH9
LinkDB
Position
24
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGTQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSITQLESLNRELQERNRILENSKSQMD
KDYYQLQAVLEAERRDRGHDSEKIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLIENKDRMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNREHLKKIQELQSEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTLSRLEETNSMLTKDIELLRKENE
ELTDKMRKAEEEYKLKKEEEINILKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNEMQAQLVEECTHKNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLSESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDLEVEPVQQAEKTGFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHIDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKAS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagacgcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtctgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaactggtaaggcataaatccaccaggaag
gtatatgctatgaagctcctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaacagtccttgggttgttcagctattt
tatgcattccaagatgatcgttatctctacatggtaatggaatacatgcctggtggagat
cttgtaaatttaatgagcaactatgatgtgcctgaaaaatgggcccgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttatccatagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcagttggaacacctgattat
atttcccctgaagtattaaaatctcaaggtggcgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacaccattttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattctcttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaggtgagattagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatcagtgggcttgggaaacacttcgagacactgtagcaccagttgtacctgatttaagt
agtgacatagacacaagtaactttgatgacttggaagaagataaaggagatgaagaaaca
ttccctatacctaaagcttttgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaacgataacagaactagctctaatgtg
gataaaagcttgcaggaaaatttgcagaaaacaatttataagctggaagaacagttacat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacgtcaaacataaaacta
gacaagataatgaaagaattggatgaagaggggactcaaagaagaaatctagaatctaca
gtatctcagattgagaaggagaaaatgttgctacagcacagaattaatgaataccaaaga
aaagcagaacaggaaaatgagaagaggaggaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagccagaattcacagcttgctaatgagaagctg
gcacaattacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gcggttagattaaggaagagtcacacagagatgagcaaatccatcactcagctagagtcc
ctaaacagagaactgcaagagagaaatagaattttagagaattccaagtcacaaatggac
aaagattattaccaactgcaggctgtattagaagccgaacgaagagacagaggtcatgat
tctgagaagattggagacctacaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatcttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaacaacttagaaatagatttaaactacaagcttaaatcatta
cagcaacggttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgttgcaatgtgtgagatggaaaaaaagctg
aaggaggagagagaagctcgagagaaggctgaaaatagggttgttcagattgagaagcag
tgttctatgctagatgttgatctgaaacaatctcagcagaagctggagcatttgattgaa
aataaagacaggatggaggatgaagttaagaatctaaccctgcagctagagcaggaatca
aataagcgactgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgaattagctcagcttacaaaacagtacagagggaatgaagggcagatgcgg
gagctgcaggatcagctggaagcggagcagtatttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaacacttaaagaaaatacaggag
ctacaaagtgaaaaagaaactcttgctactcagttggatctagcagaaacaaaggctgaa
tctgagcagttggctcgagggcttctggaagagcagtattttgaactgacccaagaaagc
aagaaagctgcttcgagaaatcgacaagagattacagataaagatcacactcttagtcgg
cttgaagaaacgaacagcatgctaaccaaagatattgaattattaagaaaagaaaatgaa
gagctaactgataaaatgaggaaggcagaggaagaatataaattgaagaaggaggaggag
atcaatatccttaaggctgcctttgaaaagaatatcaatacagaacgaacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaggactttaaaattgatagaaag
aaagcaaatacgcaggatttgagaaagaaagaaaaagaaaatcggaagctccaacttgaa
ctcaaccaggaaagagagaaattcaaccaaatggtagtgaaacatcagaaggagctgaat
gaaatgcaagcgcaattggtagaagaatgtacacataagaatgagcttcagatgcagttg
gccagcaaagagagtgacattgagcagctgcgtgccaaacttttggacctttccgattct
acgagtgttgctagttttcccagtgctgatgaaactgatggaaacctttcagaatcaaga
attgaaggttggctttcaataccaaatagaggaaatatcaaaagatatggctggaagaaa
cagtatgttgtcgtaagcagcaaaaaaattttgttctataatgatgaacaagataaggaa
caatccaatccgtctatggtattggacattgataaattgtttcatgttcgtcctgtaaca
caaggagatgtgtacagagctgaaactgaagaaattcctaaaatattccagatactgtat
gcaaatgaaggtgaatgtagaaaagacttagaggtggaaccagtacaacaagctgaaaaa
acaggttttcaaaaccacaaaggccatgagttcattcctacactctaccactttcccgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccacctcctgccctggag
tgtcgaagatgccatgttaagtgccacagagaccacatagataagaaagaggacttgatt
tctccatgtaaagtaagttatgatgtaacgtcagcaagagatatgctgctgctagcgtgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaagatccctaagaatcca
ccatctggttttgtgcgtgcatcccctcgaacactttctacaaggtccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaagctagttaa

KEGG   Capra hircus (goat): 102181692
Entry
102181692         CDS       T02910                                 

Gene name
ROCK2
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04071  Sphingolipid signaling pathway
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04510  Focal adhesion
chx04530  Tight junction
chx04611  Platelet activation
chx04670  Leukocyte transendothelial migration
chx04810  Regulation of actin cytoskeleton
chx04921  Oxytocin signaling pathway
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102181692 (ROCK2)
   04071 Sphingolipid signaling pathway
    102181692 (ROCK2)
   04024 cAMP signaling pathway
    102181692 (ROCK2)
   04022 cGMP-PKG signaling pathway
    102181692 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102181692 (ROCK2)
   04530 Tight junction
    102181692 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102181692 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102181692 (ROCK2)
   04670 Leukocyte transendothelial migration
    102181692 (ROCK2)
   04062 Chemokine signaling pathway
    102181692 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102181692 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102181692 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    102181692 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102181692 (ROCK2)
   05205 Proteoglycans in cancer
    102181692 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102181692 (ROCK2)
   05135 Yersinia infection
    102181692 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102181692 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102181692 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102181692 (ROCK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102181692 (ROCK2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   102181692 (ROCK2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102181692 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 102181692
NCBI-ProteinID: XP_017911135
LinkDB
Position
11
AA seq 1475 aa
MSRPPPTGKMPGAPEAVSGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCKENDSIQSRKNEESQEIQKKLYTLEEHLSTEIQAKEELEQKCKSVNTRLEKV
AKELEEEITLRKNVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSVLESERRDRTHGSEIINDLQGRISGLEEDVKNGKI
LLAKVELEKRQLQERFTDLEKEKNNMEIDMTYQLKVIQQSLEQEETEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLLEMKMS
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLCKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKEAQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DTEADDGFPVHITQSHTMESMSFTYQRSSTSLNIATKPSSSHMLLDSDSDSEEESVPYLP
ISSEPNGTESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLD
IDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGH
EFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDI
SSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQ
LAPNKPRLLDLAFKDWDWSFDDVDGGDDDDDVFDF
NT seq 4428 nt   +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaagatgcccggcgcccccgaggccgtgtcgggggac
ggcgcgggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctcgccc
attaacgtggagagcttgctggatggcttaaattctttggttcttgatttggattttcca
gctttgaggaaaaacaaaaatatagataatttcttaaatagatatgagaaaattgtgaaa
aagataagaggtttacagatgaaggcagaagactacgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtccagttggttcgtcataaggcatcacagaaagtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcttttttctgggaggaa
agagatattatggcctttgccaacagtccctgggtggttcagctcttttgtgcctttcaa
gatgataagtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaactatgatgtacctgaaaaatgggccaaattttatactgctgaagttgttctt
gctttggatgccatacactccatgggtttaattcacagagatgtgaagcctgacaacatg
ctcttggataaacatgggcatctaaaattagcagattttggcacatgtatgaagatggat
gaaacaggcatggtgcattgtgatacagcagttggaacacccgattatatatcacctgag
gtcctgaaatcacaagggggtgatggttactatgggcgagaatgtgattggtggtccgtg
ggtgttttcctttttgagatgctggtgggggatactccattttatgcagattcacttgta
ggaacatacagcaaaattatggatcataaaaactcactatgtttccctgaagatgcagaa
atttctaaacatgcgaagaatctcatctgtgccttcttaacagatagggaggtacgcctt
ggaagaaatggagtagaagaaatcaaacaacatcctttctttaagaatgatcagtggaat
tgggataacataagagagactgctgctcctgtggtacctgaactcagcagtgacatagac
agcagcaattttgatgacattgaagatgataaaggagatgtagaaaccttcccaattcct
aaggcttttgtgggaaatcagctaccttttataggatttacctactatagagaaaatttg
ttactaagtgattctccatcttgtaaagaaaatgactcaatacaatcaaggaagaatgaa
gagagtcaagagattcagaaaaaactgtacacattagaagaacaccttagcactgagatt
caagccaaagaggaactagaacagaagtgcaaatctgttaatactcgcttagagaaagtg
gcaaaggagttagaagaagagattaccttaaggaaaaatgtggaatcaacattaagacaa
ttagaaagagaaaaagcacttcttcagcacaaaaatgcagaatatcagcggaaagctgat
catgaagcagacaagaagcgaaatttggagaatgatgttaacagtttaaaagatcagctt
gaagatttgaaaaaaagaaatcagaactctcagatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttgctgcgaacagaatctgatactgcagcccgg
ttaaggaaaacacaggcagaaagttcaaaacagattcagcaattggaatctaacaataga
gatctacaagacaaaaattgcctgctggagaccgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagttctagaatctgaaaggagggaccgaacccatggatcagagatt
attaatgatttacaaggtagaatatctggcctagaagaagatgtcaagaatggtaaaatc
ttactagcaaaagtagagctggagaagagacaactacaggagagatttactgatttggaa
aaggaaaagaacaacatggaaatagatatgacataccaactaaaagttatacagcaaagt
ttagaacaagaagaaactgaacataaggctacaaaagcacggcttgcagacaaaaacaaa
atttatgaatccattgaagaagccaaatcagaagccatgaaagaaatggagaaaaagctc
ttggaggaaagaactttaaaacagaaagtagagaacttgttgctggaggctgagaaaaga
tgctctatattagactgtgacctcaaacagtcacagcagaaaataaatgaactcctcaaa
cagaaagatgtgctaaatgaggatgttagaaacttgacattaaaaatagaacaggaaact
cagaagcgctgccttacacaaaatgacttgaagatgcaaacacagcaagttaatacacta
aaaatgtcagaaaagcagttaaagcaagagaataatcatctcctagaaatgaaaatgagc
ttggaaaaacagaatgctgaacttcgaaaagaacgtcaagatgcagatggacaaatgaaa
gagctccaggatcagcttgaagcagagcagtatttctcaaccctctataaaacacaggtt
agggaacttaaggaagaatgtgaagaaaagaccaaactttgtaaagaattacagcagaag
aagcaggaattacaggatgaaagggactccttggctgctcaactggagattaccttaacc
aaagcagattctgagcaattggctcgttcaattgctgaggaacagtattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctcggcacaaacaggaa
ctcaccgaaaaagatgctactattgcatctcttgaagaaactaataggacactaactagt
gatgttgccaatcttgcaaatgagaaagaagaattaaataacaaattgaaagaagcccaa
gagcaactatcaaggttgaaagatgaagaaataagtgcagcagctattaaagcacaattt
gagaagcagctgttaacagagaggacactcaaaactcaagctgtgaacaagttggctgag
atcatgaatcgaaaggaacctgttaagcgtggtaatgacacagatgtgcggagaaaagaa
aaggagaatagaaagctacatatggaacttaaatctgaacgtgaaaaactgacccagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggctcaaatagctgaagagagtcag
attcgaattgaactacagatgacactggacagtaaggacagtgacattgagcagctgcgc
tcccagctccaggccttgcacattggtttggatagttccagtataggcagtggaccaggg
gatactgaagctgatgatgggtttccagttcatatcactcagtcacacactatggaatcc
atgtcattcacctaccaacgttcctccacttctctcaatattgccactaagccttccagt
tctcatatgcttcttgactctgattctgactcagaagaagaatctgttccttacttacct
atttcatcggaacctaatggtacagaatcaagactagaaggatggctttcattgcctgtg
cgaaacaacactaagaaatttggatgggttaaaaagtatgtgattgtaagcagtaagaag
atccttttctatgacagtgaacaagataaagaacaatctaatccttacatggttttagat
atagacaagttatttcatgtccgaccagttacacagacagatgtatatagagcagatgct
aaagaaattccaaggatattccagattctgtatgccaacgaaggagaaagcaagaaggaa
caagaatttccagtggagccagtgggagaaaaatcaaattatatttgccacaagggacat
gaatttattcctactctctatcatttcccaaccaactgtgaggcatgtatgaagccattg
tggcacatgtttaaaccccctcctgctttagagtgccgtcgctgtcatattaaatgtcat
aaagaccacatggacaaaaaggaggaaattatagcgccttgcaaagtgtattatgatatt
tcatcggcaaagaatctattgttattagcaaattctacagaagagcagcaaaagtgggtt
agtcggttagtgaaaaagatacctaaaaagcctccagctccagacccttttgctcggtcg
tctcctagaacatcaatgaaaatacaacaaaaccagtctattcgacggccaagtcgacaa
cttgctccaaacaaaccaagattgcttgatttggcatttaaagactgggattggtcattt
gatgatgttgatggtggtgatgatgatgacgatgtttttgatttctga

DBGET integrated database retrieval system