KEGG   Capra hircus (goat): 102171046
Entry
102171046         CDS       T02910                                 

Gene name
OTUD5
Definition
(RefSeq) OTU deubiquitinase 5
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102171046 (OTUD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102171046 (OTUD5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102171046 (OTUD5)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102171046 (OTUD5)
Peptidases and inhibitors [BR:chx01002]
 Cysteine peptidases
  Family C85
   102171046 (OTUD5)
Ubiquitin system [BR:chx04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    102171046 (OTUD5)
SSDB
Motif
Pfam: OTU Peptidase_C65
Other DBs
NCBI-GeneID: 102171046
NCBI-ProteinID: XP_017900567
LinkDB
Position
Un
AA seq 567 aa
MTILPKKKPPPPDGDPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGTA
ATGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALA
KPPSPCAPGTSSQFSTGADRATSPLVSLYPALECRALIQQMSPSAFAGLNDWDDDEILAS
VLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccgcctcccgacggcgaccccgccaacgagccg
ccgccgcccggaccgctgcccccggcgcctcgccgcggcgggggtgtaggcgtgggcggc
ggcggcacgggtgtgggcggcggcgaccgcgaccgtgactcgggcgtcgtgggggcccgt
ccccgggcttcgccaccgcctcaaggccctcttccagggccaccgggtgcgcttcaccgc
tgggcgctggccgtgccgcccggcgccgtggcgggtcctcggccacagcaggcctctcca
cctccttgcgggggccccggaggtcccggcggcggtcctggtgatgcgttgggtacagca
gcgacgggcgtgggcgcggcgggtgtggtggtgggcgtgggcggtgccgtgggtgtgggc
ggctgctgctcagggccgggtcacagcaagcggcggcgtcaggcccccggggttggtgcg
gttggcgggggcagtcctgagcgtgaggaggtcggcgcaggttacaacagtgaggatgaa
tatgaagcggctgcagcgcgcatagaggccatggaccccgccaccgtcgagcagcaggag
cactggtttgaaaaggccttgcgagacaagaagggcttcatcatcaagcagatgaaggag
gatggtgcctgtctcttccgggctgtagctgaccaggtatatggagaccaggacatgcat
gaggttgttcgaaagcactgcatggactatctgatgaagaatgctgactacttctccaac
tatgtcacagaggactttaccacctacatcaaccggaagcggaaaaacaactgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccggcctgtggaggtgtaccag
tacagcacagaacccatcaatacattccatgggatccatcaaaatgaggatgaacccatt
cgtgtcagctaccataggaatatccactacaactcagtagtgaatcctaacaaggccacc
attggcgtgggactgggcctgccatcattcaaaccggggtttgcagagcagtccctgatg
aagaatgccataaaaacatcagaggaatcatggattgaacagcagatgctggaagacaag
aagcgggccacagattgggaggccacaaatgaggccattgaggagcaggtggcccgggaa
tcctacttgcagtggctgcgggatcaagaaaaacaagctcgccaagtccgtggccccagc
cagccccggaaagccagcgccacatgcagctctgccacagcagcagcctccagtggtctt
gaggagtggaccagccggtccccaaggcagcggagttcagcgtcgtcacctgagcaccct
gagctgcatgctgagctgggcatcaagcccccttccccaggcactgtcttagctcttgcc
aaacctccttcaccctgtgcaccaggtacaagcagccagttctcgacaggggccgaccgg
gctacttccccccttgtgtccctttaccctgctctggagtgccgggccctcattcagcag
atgtccccctccgcctttgcaggtctgaatgactgggatgatgatgagatcctagcctcg
gtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacaga
gacccacccccagacaagagttga

DBGET integrated database retrieval system