KEGG   Capra hircus (goat): 102171058
Entry
102171058         CDS       T02910                                 

Gene name
TMEM173, STING
Definition
(RefSeq) transmembrane protein 173
  KO
K12654  transmembrane protein 173
Organism
chx  Capra hircus (goat)
Pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx05163  Human cytomegalovirus infection
chx05168  Herpes simplex virus 1 infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102171058 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    102171058 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    102171058 (TMEM173)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102171058 (TMEM173)
   05171 Coronavirus disease - COVID-19
    102171058 (TMEM173)
   05168 Herpes simplex virus 1 infection
    102171058 (TMEM173)
   05163 Human cytomegalovirus infection
    102171058 (TMEM173)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102171058 (TMEM173)
Membrane trafficking [BR:chx04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    102171058 (TMEM173)
SSDB
Motif
Pfam: TMEM173
Other DBs
NCBI-GeneID: 102171058
NCBI-ProteinID: NP_001306207
UniProt: A0A0M4QBF3
LinkDB
Position
7
AA seq 378 aa
MPHSSLHPSIPQPRGHRAQKAALVLLSACLVALWGLGEPPDYTLKWLVLHLASQQMGLLI
KGICSLAEELRHVHSRYHGSYWRAVRACLCSSMRCGALLLLSCYFYCSLPNMAGLPFTWM
LALLGLSQALNILLGLQGLAPAEVSAICEKRNFNVAHGLAWSYYIGYLRLILPGFRARIQ
IYNQFHNNTLQGAGSHRLHILFPLDCGVPDDLSVVDPNIRFLHELPQQSANRAGIKGRVY
TNSIYELLENGQRAGICVLEYATPLQTLFAMSQDGRAGFSREDRLEQAKLFCRTLEDILA
NAPESQNNCRLIVYQEPAEGSSFSLSQEILQHLRQEEREVTMGSMETSVIPASSALSQEP
ELLISGMEKPLPLRSDVF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcctcactccagcctgcatccatccatcccacagcccaggggtcacagggcccaaaag
gcagccttggtcctgctaagtgcctgtctggtggccctttggggcctgggggagccacca
gactacactctcaagtggttggtgctccacctggcctcccagcagatgggactgctgatc
aaggggatctgcagtctagccgaggagctgcgccacgtccactccaggtaccacggcagc
tactggagggctgtgcgggcctgcctgtgctcctccatgcgctgcggggccctgctgctg
ctgtcctgctatttctactgctccctcccaaacatggctggcctgcccttcacttggatg
cttgctctcctgggcctctcacaggcacttaacatcctcctgggcctccagggcctggcc
ccagcagaggtctctgcaatctgtgaaaaaaggaacttcaacgtggctcatgggctggcc
tggtcatattatattggatacctgcggctgatcctgccagggttccgggcccggatccaa
atttacaatcagttccacaacaacacgctacagggtgcagggagccaccggctgcacatc
ctcttcccgttggactgtggggtgcctgacgacctgagcgtggttgaccccaacattcgc
ttcctacacgagctgccccagcagagtgccaaccgtgctggcatcaagggccgggtttac
accaacagcatctatgagcttctggaaaatgggcagcgggcaggcatctgtgtcctggaa
tatgccacccccttgcagaccctgttcgccatgtcacaggatggccgagctggctttagc
cgagaggatcggctggaacaggccaaactcttctgccggacacttgaagacatcctggca
aatgcccctgagtctcagaacaactgccgcctcattgtctaccaggaacctgcagaggga
agcagcttctccttgtcacaggaaattctccagcaccttcggcaggaggaaagggaggtt
accatgggtagcatggagacctctgtgatacccgcttcctctgcactgtcccaagagcct
gagctcctcatcagtggcatggaaaagcctctcccactccgctcagatgtcttctga

DBGET integrated database retrieval system