KEGG   Capra hircus (goat): 102171262
Entry
102171262         CDS       T02910                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04110  Cell cycle
chx04151  PI3K-Akt signaling pathway
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04350  TGF-beta signaling pathway
chx04390  Hippo signaling pathway
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04630  JAK-STAT signaling pathway
chx04919  Thyroid hormone signaling pathway
chx05132  Salmonella infection
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05216  Thyroid cancer
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102171262 (MYC)
   04012 ErbB signaling pathway
    102171262 (MYC)
   04310 Wnt signaling pathway
    102171262 (MYC)
   04350 TGF-beta signaling pathway
    102171262 (MYC)
   04390 Hippo signaling pathway
    102171262 (MYC)
   04630 JAK-STAT signaling pathway
    102171262 (MYC)
   04151 PI3K-Akt signaling pathway
    102171262 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102171262 (MYC)
   04218 Cellular senescence
    102171262 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102171262 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102171262 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102171262 (MYC)
   05202 Transcriptional misregulation in cancer
    102171262 (MYC)
   05206 MicroRNAs in cancer
    102171262 (MYC)
   05205 Proteoglycans in cancer
    102171262 (MYC)
   05230 Central carbon metabolism in cancer
    102171262 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102171262 (MYC)
   05225 Hepatocellular carcinoma
    102171262 (MYC)
   05226 Gastric cancer
    102171262 (MYC)
   05216 Thyroid cancer
    102171262 (MYC)
   05221 Acute myeloid leukemia
    102171262 (MYC)
   05220 Chronic myeloid leukemia
    102171262 (MYC)
   05219 Bladder cancer
    102171262 (MYC)
   05213 Endometrial cancer
    102171262 (MYC)
   05224 Breast cancer
    102171262 (MYC)
   05222 Small cell lung cancer
    102171262 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102171262 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102171262 (MYC)
   05161 Hepatitis B
    102171262 (MYC)
   05160 Hepatitis C
    102171262 (MYC)
   05163 Human cytomegalovirus infection
    102171262 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102171262 (MYC)
   05169 Epstein-Barr virus infection
    102171262 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102171262 (MYC)
   03019 Messenger RNA biogenesis [BR:chx03019]
    102171262 (MYC)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102171262 (MYC)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102171262 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102171262
NCBI-ProteinID: XP_017914052
UniProt: A0A452EI51
LinkDB
Position
14
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSPSPARGHGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPAAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDVL
RKRREQLKLKLEQIRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacagaaactatgacctcgactacgattcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccaccagcagcagcagagcgaactg
cagccgccggcgcccagcgaggacatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccgtcgtacgtcgcggtcgcctccttc
tcgcccaggggagacgacgacggcggcggcggcagcttttcctccgcggaccagttggag
atggtgaccgagctgctgggaggcgacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctgcacgcaaagacggcggc
agcccgagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgaatgcatcgacccctcggtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctccccggactccaccgccttctccccctcctct
gactctctgctctcctctgctgagtcctccccgcgggccagtcccgagcccctggcgctc
cacgaggagaccccacccacgaccagcagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtctctgtggaaaagaggcagcccgctgccaaaaggtcagaatcgggg
tcaccctctgccggcagccacagcaaacctcctcacagcccgttggtcctaaagagatgc
cacgtgtctacccatcagcacaattacgcagcgcccccctccactaggaaggactatccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgc
aaatgtgccagcccgaggtcttcggacacggaggagaatgacaagaggcggacacacaac
gttttggagcgccagaggagaaacgagctgaaacgcagcttttttgctcttcgtgaccag
atcccagagttggagaacaatgaaaaagcccccaaagtagttatccttaaaaaagccaca
gcatacatcctgtcggtccaagcagaggagcaaaagctcatttcagaaaaagacgtgttg
cggaagaggcgagaacagttgaaactcaaacttgaacagatacggaactcttgcgcctaa

DBGET integrated database retrieval system