KEGG   Capra hircus (goat): 102171588
Entry
102171588         CDS       T02910                                 

Gene name
DDX3X
Definition
(RefSeq) DEAD-box helicase 3, X-linked
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
chx05161  Hepatitis B
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102171588 (DDX3X)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102171588 (DDX3X)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102171588 (DDX3X)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chx03019]
    102171588 (DDX3X)
   03041 Spliceosome [BR:chx03041]
    102171588 (DDX3X)
   03036 Chromosome and associated proteins [BR:chx03036]
    102171588 (DDX3X)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102171588 (DDX3X)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     102171588 (DDX3X)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102171588 (DDX3X)
Spliceosome [BR:chx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    102171588 (DDX3X)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    102171588 (DDX3X)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 102171588
NCBI-ProteinID: XP_005700967
UniProt: A0A452G0P2
LinkDB
Position
Un
AA seq 661 aa
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRGDYDGIGGRGDRGGFGKYE
RGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIES
FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ
IYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVY
GGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQI
RRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVW
VEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLA
TSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARD
YRQSSGGSSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWG
N
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcggtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttcagataatcagagtggaggaagtacagccagcaaagggcgctatattcct
cctcacttaaggaacagagaagctactaaaggattctatgataaagacagttcagggtgg
agttctagtaaagataaggatgcatacagcagttttggttcccgaagtgattcaagagga
aagtctagtttcttcagtgatcgtggaagtggatcaaggggaaggtttgatgatcgtgga
cgaggtgactatgacggcattggcggccgtggtgacagaggtggttttggcaaatatgaa
cgtggaaatagtcgctggtgtgacaaatcagatgaagatgattggtcaaaaccactccca
ccaagtgaacgcttggaacaagaactcttttctggaggcaacactgggattaactttgaa
aaatatgatgacattccagttgaggcaacaggcaacaactgtcctccacacattgaaagt
ttcagtgatgttgagatgggagaaattattatgggaaacattgagcttactcgttacact
cgcccaactccagtgcaaaagcatgctattcctattatcaaagagaagagagacttgatg
gcctgtgcccaaacagggtctggaaaaactgcagcatttctcttgcccatcttgagtcag
atttattctgatggtcccggcgaggctctgagggccatgaaggaaaatggaagatacggg
cgccgcaaacaatacccaatctctttggtgttagcaccaactagagaattggctgtacag
atctatgaggaagccaggaaattttcataccgatctagagttcgtccttgcgtggtttat
ggtggtgctgatattggtcagcaaattcgagacttggaacgtggatgccatttgttagtt
gcgactccaggacgtctagtggatatgatggaaagaggaaaaattggattagacttctgc
aagtacttggtgttagatgaagcagatcggatgttggatatggggtttgaacctcagata
cgtagaatcgttgaacaagatactatgccaccaaagggagttcgccacactatgatgttt
agtgctactttccctaaggaaatacagatgcttgctcgtgacttcttggatgagtatatc
tttttggccgtaggaagagttggctctacctctgagaacataacacagaaagtagtttgg
gttgaagagtcagacaaacggtcatttctgcttgatcttctaaatgcaacaggcaaagat
tcactgaccttagtgtttgtggagaccaaaaagggtgcagattctctggaggatttctta
taccatgaaggatatgcttgtaccagtatccatggagaccgatctcagagagatagagaa
gaggcccttcaccagttccgctcaggaaaaagcccaattctcgtggctacagcagtagca
gcaagaggactggacatatcaaatgtgaaacatgttatcaattttgacttgccaagtgat
attgaagaatatgtacatcgcattggccgtacaggacgtgtaggaaaccttggccttgcc
acctcattctttaatgagaggaacataaatattaccaaggatttgttggatcttcttgtt
gaagctaaacaggaagtgccatcttggttagaaaacatggcttatgaacaccactacaag
ggtagcagtcgtggacgatccaaaagtagtagattcagtggaggatttggtgccagagac
tatcgacagagtagtggtggcagcagttccagcttcagcagcagccgcgccagcagcagc
cgcagtggtggaggcggccatggaagcagcagagggtttggtggaggtggctatggaggc
ttttacaacagtgatggatatggaggaaattataactcccagggggttgactggtggggt
aactga

KEGG   Capra hircus (goat): 108634620
Entry
108634620         CDS       T02910                                 

Definition
(RefSeq) ATP-dependent RNA helicase DDX3X-like
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
chx05161  Hepatitis B
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    108634620
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    108634620
  09172 Infectious disease: viral
   05161 Hepatitis B
    108634620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chx03019]
    108634620
   03041 Spliceosome [BR:chx03041]
    108634620
   03036 Chromosome and associated proteins [BR:chx03036]
    108634620
Enzymes [BR:chx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108634620
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     108634620
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     108634620
Spliceosome [BR:chx03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    108634620
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    108634620
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 108634620
NCBI-ProteinID: XP_017900160
UniProt: A0A452E4N1
LinkDB
Position
Un
AA seq 660 aa
MSHEAVKNVQEVDQQLADLNLNSDNNQSGGGSTASKGRYIPPHLRNREASKGFYGKDSSG
WSCSKEKDAYSSFGSRDSRGRPSYFSDRGSGSRGRFDDRGRNDCEGIGSRGDRTGFGRYE
RSGHSRWCDKSDDDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEVTGNNCPPHIE
SFSDVAMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYTDGPGEALKAVKENGRHGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVLPCVV
YGGADIGQQIRELERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEEADKRSFLLDLLNATGTDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNINIAKDLLDLLVEAKQEVPSWLENMAYEHHYKSSSRGRSKRFSGGFGARDY
RQSSSSGSSSYSSGRASSSRSGGGGHGSSRGFGGGGYGGFYSSEGYGGNYSSQGVDWWGN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgagtcatgaggcggtgaaaaacgtgcaggaggtggatcagcagttggctgatctaaac
ctgaactctgataataatcagagtggaggaggaagtacagctagcaaagggcgctatata
cctcctcacttaagaaatagggaagcatctaaaggattttatggtaaagacagttcaggg
tggagctgtagtaaagaaaaggatgcctacagcagttttggatctcgagattcaagagga
agacccagttacttcagtgatcgaggaagtggatcaaggggaaggtttgatgatcgtggg
cggaatgactgtgaaggtattggcagtcgtggtgacagaactggctttggcagatatgag
cgtagtggacacagtcgttggtgtgacaagtcagatgatgatgattggtcaaaaccactt
ccaccaagtgaacgcttggagcaggagctcttttctggaggaaacactgggattaacttt
gagaaatatgatgatataccagtagaggtaactggcaataactgtcctccacacattgaa
agtttcagcgatgttgcaatgggagaaattattatgggaaacattgagcttactcgttac
acacgtcctactccagtgcaaaaacatgccattcccattattaaagaaaaaagagacctg
atggcttgtgcccaaacagggtctgggaaaactgcagcattccttttgcccatcttgagt
cagatttatacagatggtccaggcgaggctttgaaagctgtgaaggaaaatggaaggcat
ggacgccgtaaacagtatccaatctccttggttttagccccaacaagagagctggctgta
cagatctatgaggaagccaggaaattttcataccggtctcgagttcttccttgtgtggta
tacggtggtgctgatattgggcaacagattcgagagttagaacgtggatgtcacttgtta
gttgctactccaggacgcctggtggatatgatggaaagaggaaagattgggttagatttc
tgcaaatacttggtgttggatgaagctgataggatgctggatatgggatttgaacctcaa
attcgtcgtatagttgaacaagacactatgccaccaaagggtgttcgccataccatgatg
tttagtgctacttttcctaaggaaattcagatgcttgctcgtgacttcttggatgaatat
atcttcctggccgtaggtagagttggttctacctctgagaacatcacacaaaaagtagtt
tgggtggaagaggcagacaaacggtcatttctgcttgatctcttaaatgcaacagggacg
gattctctgactttagtttttgtggagaccaaaaaaggggctgattctttggaggatttc
ttataccatgaaggatatgcttgtacaagtatccatggagaccgatcacagagagataga
gaggaagctcttcatcagttccgctcaggaaaaagcccaattctagtggctactgctgtg
gcagcaagaggactagacatttcgaatgtgaaacatgtcatcaattttgatttgccaagt
gatattgaggaatatgtacatcggattggccgtacaggacgtgtaggaaaccttggactt
gccacctcatttttcaatgaaagaaatataaatatcgcaaaagatttgttggatcttctt
gttgaagccaaacaagaagtgccatcttggttggaaaacatggcctatgaacaccactat
aagagtagcagtcgtggccgttctaagagattcagtggaggctttggtgcccgtgattat
cgacaaagtagcagttctggcagctccagctatagtagtggtcgtgcaagcagcagccgc
agtggtggaggtggtcatggcagcagcagaggatttggtggaggtggctatggaggcttc
tacagtagtgaaggatatggaggaaattacagctctcagggggttgactggtggggcaac
tga

DBGET integrated database retrieval system