KEGG   Capra hircus (goat): 102171591
Entry
102171591         CDS       T02910                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
chx  Capra hircus (goat)
Pathway
chx01523  Antifolate resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04920  Adipocytokine signaling pathway
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05212  Pancreatic cancer
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05340  Primary immunodeficiency
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102171591 (IKBKG)
   04014 Ras signaling pathway
    102171591 (IKBKG)
   04064 NF-kappa B signaling pathway
    102171591 (IKBKG)
   04668 TNF signaling pathway
    102171591 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102171591 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102171591 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102171591 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102171591 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102171591 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102171591 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102171591 (IKBKG)
   04660 T cell receptor signaling pathway
    102171591 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102171591 (IKBKG)
   04659 Th17 cell differentiation
    102171591 (IKBKG)
   04657 IL-17 signaling pathway
    102171591 (IKBKG)
   04662 B cell receptor signaling pathway
    102171591 (IKBKG)
   04062 Chemokine signaling pathway
    102171591 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102171591 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102171591 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102171591 (IKBKG)
   05203 Viral carcinogenesis
    102171591 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102171591 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102171591 (IKBKG)
   05221 Acute myeloid leukemia
    102171591 (IKBKG)
   05220 Chronic myeloid leukemia
    102171591 (IKBKG)
   05215 Prostate cancer
    102171591 (IKBKG)
   05222 Small cell lung cancer
    102171591 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102171591 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102171591 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102171591 (IKBKG)
   05135 Yersinia infection
    102171591 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102171591 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102171591 (IKBKG)
   05161 Hepatitis B
    102171591 (IKBKG)
   05160 Hepatitis C
    102171591 (IKBKG)
   05171 Coronavirus disease - COVID-19
    102171591 (IKBKG)
   05164 Influenza A
    102171591 (IKBKG)
   05162 Measles
    102171591 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102171591 (IKBKG)
   05163 Human cytomegalovirus infection
    102171591 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102171591 (IKBKG)
   05169 Epstein-Barr virus infection
    102171591 (IKBKG)
   05165 Human papillomavirus infection
    102171591 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102171591 (IKBKG)
   05142 Chagas disease
    102171591 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102171591 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102171591 (IKBKG)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102171591 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB LLC1 zf_C2H2_ZHX Filament
Other DBs
NCBI-GeneID: 102171591
NCBI-ProteinID: XP_005701396
UniProt: A0A452FU17
LinkDB
Position
Un
AA seq 407 aa
MVQPSGGPAGDQDMLGEESSLGKPAMLHMPSEQGTPETFQRCLEENQELRDAIRQSNQML
RERCEELQRFQGNQREEKAFLMQKFQEARDLVARLSLEKRKLRQQREQALQEVERLKTCQ
QQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEQARQLESEREALQ
QRHSVQVDQLRLQNQNMEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDSHIKSSMVSS
ERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF
QAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRHVEVSQPPLTPAP
AHHSFNLALPSQRRSPPDEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggtgcagccgagtggtggcccggcaggggaccaggacatgctaggtgaagagtcttct
ctggggaagccagccatgctccacatgccttcagagcagggcacccctgagaccttccag
cgctgtctggaggagaatcaagagctccgagacgccatccgccagagcaaccagatgctg
cgcgagcgctgtgaggagctgcagcgtttccagggcaaccagagggaggagaaggccttc
ctcatgcagaagttccaggaggccagggacttggtggcgaggctgagcctagagaagcgc
aaactgcgacagcagagggagcaggccctacaggaggtggaacgcctgaagacatgccag
cagcagatggctgaggacaaggcctcagtgaaagcccaggtaacatccttgctgggggag
ctgcaggagagccagagtcggttggaggctgccactaaggagcgccaggctttggagagc
agggcccgggtggccagcgaacaggcccggcagctggagagtgagcgggaggcgctgcaa
cagcggcacagtgtgcaggtggaccagctgcgtctgcagaaccagaacatggaggctgcc
ctgcgcatggaacgccaggccgcctcagaggagaagcggaagctggcccagctgcaggtg
gcttatcaccagctcttccaagagtatgacagccacatcaagagcagcatggtgagcagt
gagcggaaccgaggactgcagctggaggatctcaagcagcagctccagcaggctgaggag
gccctggtggccaaacaggaagtgatcgacaagctaaaggaggaggcagaacagcacaag
attgtgatggagactgtcccagtgctaaaagcccaggcggatatctacaaggcagatttc
caggctgagaggcaggcccgggagaagctggctgagaagaaggaattcctgcaagaacag
ctggagcagctgcagagggaatatagcaggttgaagaccagctgtcaggagtcagccagg
attgaagacatgaggaagcggcatgttgaggtctcccagccccccttaacccctgcccca
gctcatcactcctttaacctggccctgcccagccagaggagaagcccccctgacgagccg
cccaacttctgctgccccaagtgtcagtatcaggctcctgacatggacaccctgcagata
cacgtcatggagtgcatcgagtag

KEGG   Capra hircus (goat): 102177406
Entry
102177406         CDS       T02910                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
chx  Capra hircus (goat)
Pathway
chx01523  Antifolate resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04068  FoxO signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04910  Insulin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx05010  Alzheimer disease
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05206  MicroRNAs in cancer
chx05212  Pancreatic cancer
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102177406 (IKBKB)
   04014 Ras signaling pathway
    102177406 (IKBKB)
   04064 NF-kappa B signaling pathway
    102177406 (IKBKB)
   04668 TNF signaling pathway
    102177406 (IKBKB)
   04068 FoxO signaling pathway
    102177406 (IKBKB)
   04151 PI3K-Akt signaling pathway
    102177406 (IKBKB)
   04150 mTOR signaling pathway
    102177406 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102177406 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102177406 (IKBKB)
   04621 NOD-like receptor signaling pathway
    102177406 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    102177406 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    102177406 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    102177406 (IKBKB)
   04660 T cell receptor signaling pathway
    102177406 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    102177406 (IKBKB)
   04659 Th17 cell differentiation
    102177406 (IKBKB)
   04657 IL-17 signaling pathway
    102177406 (IKBKB)
   04662 B cell receptor signaling pathway
    102177406 (IKBKB)
   04062 Chemokine signaling pathway
    102177406 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102177406 (IKBKB)
   04920 Adipocytokine signaling pathway
    102177406 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102177406 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102177406 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102177406 (IKBKB)
   05206 MicroRNAs in cancer
    102177406 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102177406 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102177406 (IKBKB)
   05221 Acute myeloid leukemia
    102177406 (IKBKB)
   05220 Chronic myeloid leukemia
    102177406 (IKBKB)
   05215 Prostate cancer
    102177406 (IKBKB)
   05222 Small cell lung cancer
    102177406 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102177406 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102177406 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102177406 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    102177406 (IKBKB)
   04931 Insulin resistance
    102177406 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102177406 (IKBKB)
   05135 Yersinia infection
    102177406 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102177406 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    102177406 (IKBKB)
   05161 Hepatitis B
    102177406 (IKBKB)
   05160 Hepatitis C
    102177406 (IKBKB)
   05171 Coronavirus disease - COVID-19
    102177406 (IKBKB)
   05164 Influenza A
    102177406 (IKBKB)
   05162 Measles
    102177406 (IKBKB)
   05168 Herpes simplex virus 1 infection
    102177406 (IKBKB)
   05163 Human cytomegalovirus infection
    102177406 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102177406 (IKBKB)
   05169 Epstein-Barr virus infection
    102177406 (IKBKB)
   05165 Human papillomavirus infection
    102177406 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102177406 (IKBKB)
   05142 Chagas disease
    102177406 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102177406 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102177406 (IKBKB)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102177406 (IKBKB)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102177406 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH ubiquitin YrbL-PhoP_reg Med20 GTSE1_N Glyco_hydro_65m
Other DBs
NCBI-GeneID: 102177406
NCBI-ProteinID: XP_017897459
LinkDB
Position
27
AA seq 856 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPHPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLLHVLNMVTGTLHTYPVTEDESLQSLKARIRQDTGILEEDQELLQEAGLA
LIPDKPAAQCLSDGKLNEGRTLDMDLVFLFDNSRVTYESQVSPQPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYREQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMSEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPSQLMSQPCATPDSLPEAAEKSEDLVAEAHTLCTQLE
NALQDTMKEQDQSLRVMAHGEPRCSTPFLFCSKREAEREATPCRLDLSVHLGFSGTTFIF
IMITGLTTVERARVPYVLCLLSSSLCLVLMRPVASLGEGLSPALPFCAVAGHACERCSAG
LQGQSCHHPISQGLGA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgtggggcctgggaaatgaaagagcgg
cttgggacagggggatttgggaacgtcatccgatggcacaatcaggagacgggtgagcag
atcgccatcaagcagtgccggcaggagctcagtccccggaaccgcgagcgctggtgcctg
gagatccagatcatgaggaggctgaaccatcccaatgtggtggctgcccgggacgtccct
gaaggcatgcagagcctggctcccaacgacctgcccctgctggcgatggagtactgtcag
ggcggggacctgcgcaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagcgacatcgcctctgcacttcgataccttcatgagaacaga
atcatccatcgggatctgaagccagaaaacattgtcctgcagcaaggggagcagagatta
atacacaaaattattgacctgggatatgccaaggagctggaccagggcagcctctgcacg
tccttcgtggggaccctgcagtacctggcccccgagctgctggagcagcagaagtacacg
gtgacggtggactactggagcttcggcaccttggccttcgagtgcatcactggcttccgg
ccgttcctgcccaactggcagccggtgcagtggcactccaaagtccggcagaagagcgag
atggacatcgtggtgagcgaggacctgaacggggccgtgaagttctccagctcgctgccg
caccccaacaacctcaacagcgtcctggcccagcggctggagaagtggctacagctaatg
ctgatgtggcacccgcgccagaggggcaccgaccccgtctacgggcccaatggctgcttc
aaggccctggacgacatcttgaacttgaagctgcttcatgtcctgaacatggtcacgggc
accctgcacacctaccccgtgaccgaggacgagagcctgcagagcctgaaggcccgcatc
cgccaggacacaggcatcctcgaggaggaccaggagctgctgcaggaggcggggctggcc
ctgatccccgacaagcccgcggcccagtgcctctcagatggcaagctgaacgagggccga
acgctggacatggacctcgttttcctctttgacaacagcagggtcacctatgaaagccag
gtctccccacagccccagcctgaaagcgtcagctgcatcctgcaagagcccaagaggaac
ctcccgttcttccagctgcggaaggtgtggggccaagtctggcacagcatccaggccctg
aaggaagactgcagccgcctgcagcagggccagcgcgcggccatgatgaatttgctgcgg
aacaacagctgtctgtccaagatgaagaactccatggcctccatgtctcagcagctcaag
gccaagctggacttctttaaaaccagcatccagattgacctggagaagtacagggagcag
acggagtttgggatcacgtcggacaagctgctgctagcctggagggagatggagcaggcc
gtggagctctgcggacgggagaacgaggtgaagcacttggtggagcggatgatggccctg
cagacagacatcgtggacctgcagcgcagccccatgggccggaagcagggcgggacgctg
gacgacctagaagagcaggcgcgggagctttaccgcaggctgagggagaaaccgagagac
cagcggactgatggtgacagtcaggaaatggtgcggctgctcctccaggcaatccaaggc
tttgagaagaaagtgcgagtgatttacacgcagctcagtaagaccgtggtctgcaagcag
aaggccctggagctgctgcccaaggtggaggaggtggtcagcctgatgagcgaggacgag
aagacggtggtgcggctgcaggagaaacggcagaaggagctctggaacctcctgaagatc
gcgtgtagcaaggtccggggtcccgtcagcgggagcccggacagcatgaacgcctcccgc
ctgagtcaccccagccagctgatgtcgcagccctgcgcgactcctgacagcttgcccgag
gccgccgagaagagtgaagacctggtggctgaagctcacaccctgtgcacccagctggag
aacgccctgcaggacaccatgaaggagcaggaccagagtttgagggtaatggcccacggg
gagccccgctgctccacaccttttcttttctgcagcaaacgagaagctgagagagaggcg
acgccctgccgccttgatctcagtgtacacttgggattttctggtacaaccttcatattc
atcatgataacagggctgacgactgttgaacgagcacgggtaccttacgtgctctgtctc
ctctcatcctcactgtgcttggtccttatgaggccggtagcatccctgggagaaggcctc
tctcccgctcttcccttctgtgcagttgctgggcatgcatgtgagaggtgcagtgctggg
ctccagggacaaagctgtcaccaccccatctctcagggacttggagcttag

KEGG   Capra hircus (goat): 102181262
Entry
102181262         CDS       T02910                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
chx  Capra hircus (goat)
Pathway
chx01523  Antifolate resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04068  FoxO signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04920  Adipocytokine signaling pathway
chx05010  Alzheimer disease
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05212  Pancreatic cancer
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102181262 (CHUK)
   04014 Ras signaling pathway
    102181262 (CHUK)
   04064 NF-kappa B signaling pathway
    102181262 (CHUK)
   04668 TNF signaling pathway
    102181262 (CHUK)
   04068 FoxO signaling pathway
    102181262 (CHUK)
   04151 PI3K-Akt signaling pathway
    102181262 (CHUK)
   04150 mTOR signaling pathway
    102181262 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102181262 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102181262 (CHUK)
   04621 NOD-like receptor signaling pathway
    102181262 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    102181262 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    102181262 (CHUK)
   04625 C-type lectin receptor signaling pathway
    102181262 (CHUK)
   04660 T cell receptor signaling pathway
    102181262 (CHUK)
   04658 Th1 and Th2 cell differentiation
    102181262 (CHUK)
   04659 Th17 cell differentiation
    102181262 (CHUK)
   04657 IL-17 signaling pathway
    102181262 (CHUK)
   04662 B cell receptor signaling pathway
    102181262 (CHUK)
   04062 Chemokine signaling pathway
    102181262 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102181262 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102181262 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102181262 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102181262 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102181262 (CHUK)
   05221 Acute myeloid leukemia
    102181262 (CHUK)
   05220 Chronic myeloid leukemia
    102181262 (CHUK)
   05215 Prostate cancer
    102181262 (CHUK)
   05222 Small cell lung cancer
    102181262 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102181262 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102181262 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102181262 (CHUK)
   05135 Yersinia infection
    102181262 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102181262 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    102181262 (CHUK)
   05161 Hepatitis B
    102181262 (CHUK)
   05160 Hepatitis C
    102181262 (CHUK)
   05171 Coronavirus disease - COVID-19
    102181262 (CHUK)
   05164 Influenza A
    102181262 (CHUK)
   05162 Measles
    102181262 (CHUK)
   05168 Herpes simplex virus 1 infection
    102181262 (CHUK)
   05163 Human cytomegalovirus infection
    102181262 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102181262 (CHUK)
   05169 Epstein-Barr virus infection
    102181262 (CHUK)
   05165 Human papillomavirus infection
    102181262 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102181262 (CHUK)
   05142 Chagas disease
    102181262 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102181262 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102181262 (CHUK)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102181262 (CHUK)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102181262 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 102181262
NCBI-ProteinID: XP_017896836
UniProt: A0A452EYD5
LinkDB
Position
26
AA seq 740 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSEMGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNTNLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGVTPQLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHLSTIIH
EANEKQGDSMMSLDWSWLTE
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggtggcttcgggaacgtctgcctgtatcaacatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgacgttcct
gaggaattgaattttttgattaacgatgtgcctcttctagcaatggaatattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatataggatctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggcggaaagattatg
cataaaataattgatttgggatatgccaaagatgttgatcaaggaagtctttgtacatct
tttgtgggaactttgcagtatctggccccagagctctttgagaataagccttatacagcc
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacttggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagaaatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctgcagttgatgcta
aactgggatcctcagcagagaggaggacctgttgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacatatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgggaaactggaataaatactggttctcaagagcttctttcagagatgggaatt
tctctggatcctcggaaaccagcctctcagtgtgttctggatggagttaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atccagttgcgtaaagtttgggctgaagcagtacactatgtgtctgggctgaaagaagac
tacagcaggctctttcagggacagagagcagccatgttaagccttcttagatacaatact
aacttgacaaaaatgaaaaacactttgatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacgtac
gggatatcctcagaaaaaatgttaaaagcttggaaagaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggatacctggaggatcaaatcatgtccctgcacactgaa
atcatggagctacagaagagcccctatggacgacgtcagggagacttgatggaatctctg
gaacagcgtgcaattgatctatataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgctcggtcccttgtaggatccagtctagaaggtgtaacccctcagctgccccca
acttcagcagaacgtgaacatcctctgtcatgcgtggtaactcctcaagatggggagact
ttagcacaaatgatagaagaaaatttgaactgtcttggccatttaagcactattattcat
gaagcaaatgaaaaacagggcgacagtatgatgagtcttgattggagttggttaacagaa
tga

DBGET integrated database retrieval system