KEGG   Capra hircus (goat): 102171671
Entry
102171671         CDS       T02910                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04141  Protein processing in endoplasmic reticulum
chx04151  PI3K-Akt signaling pathway
chx04211  Longevity regulating pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04668  TNF signaling pathway
chx04728  Dopaminergic synapse
chx04911  Insulin secretion
chx04915  Estrogen signaling pathway
chx04918  Thyroid hormone synthesis
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx05020  Prion disease
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05034  Alcoholism
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102171671 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102171671 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102171671 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102171671 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102171671 (ATF6B)
   04915 Estrogen signaling pathway
    102171671 (ATF6B)
   04926 Relaxin signaling pathway
    102171671 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102171671 (ATF6B)
   04918 Thyroid hormone synthesis
    102171671 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102171671 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102171671 (ATF6B)
   04927 Cortisol synthesis and secretion
    102171671 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102171671 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102171671 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102171671 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102171671 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102171671 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102171671 (ATF6B)
   05031 Amphetamine addiction
    102171671 (ATF6B)
   05034 Alcoholism
    102171671 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102171671 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102171671 (ATF6B)
   05161 Hepatitis B
    102171671 (ATF6B)
   05163 Human cytomegalovirus infection
    102171671 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102171671 (ATF6B)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102171671 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 102171671
NCBI-ProteinID: XP_017894405
LinkDB
Position
23
AA seq 722 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTQLFRCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPACFPPDLQVKSEPSSPCSSSSFSSESSHLSTEPFSQAPGV
REMLVVKSESLAPPLCLLGDDPTSPFETINVSPTSDDPSDVQIKIEPASPSSSISSEAPL
LSAESPSQVSMHSAAPSSTPAFIGEEVLEVKTESPSPQGCLLQDVAGPLPGAVQISVGLS
SDGSSGKALPARKPPLQPKPVVITTVPMPLRAVPASTTVLLQPLVQPPPVSPVVLIQGAV
RVRPEGPTPPTPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKE
YLQGLEARLQAVLADNQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIA
FNFGPVSISEPPPASISPRMSRGESRPRRHLLEFSAQEPVHGAEHPQHPFQDPEEPQPSP
TGRPSFRNLTAFSGDARELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRR
KTPQRAQEKQKSQLWKKSPPVQAVPTRPPGPPEGDSMGQLQLYRQPDRSQPEFLDAIDRR
EDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECE
VMDTRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAASQGHQAAHQPSTSIISDLYD
SH
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagtgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtacgccggcttggatgaagtggccgag
gagcagacgcagctcttccgttgtccggagcaggatgtcccgtttggcagcagctccctg
gacctggggatggacgtcagccctcctgaacccccctgggactctctgcctatcttccca
gcctgttttcctccagatctccaggtgaagtctgagccatcctccccctgctcttcctcc
tccttcagctctgaatcatcgcatctttccacagagcccttcagccaggcccctggtgta
agggagatgctggttgtgaagtcagagtccttggcacccccactctgcctcctgggagat
gatccaacatccccatttgaaaccatcaatgtcagccccacctctgatgatccttcagat
gttcagattaagatagagcctgcctctccgtcttcctccatcagctcggaggctcccctg
ctctctgcggagtctcccagccaggtgagcatgcactccgctgctccctccagcacgcca
gctttcataggagaggaggtcctggaagtaaaaacagagtccccgtcccctcagggatgt
ctcctgcaggatgtcgccggcccccttcctggagctgtccaaatcagcgtgggcctatcc
tctgatggctcctcaggcaaagccctgcccgcccggaagccaccactgcagcccaaacct
gtggtgataaccactgtcccgatgccactgagagccgtgcccgccagcaccaccgtcctc
ttgcagccccttgtccagccacccccagtgtccccagtggtcctcatccaaggtgctgtt
cgagtccggcctgagggaccgacccctcctactccacggcctgagaggaagagcattgtt
ccagcccctatgcctgggaactcctgcccacctgaggtggatgccaagctgctcaagcgg
cagcagcggatgatcaagaaccgggagtcggcctgccagtcccgcaggaagaagaaagag
tacctgcaggggctggaagctcggctgcaggccgtcctggccgacaaccagcagctccgg
cgggagaatgctgccctccgccggcggctggaggccctgctgactgagaacagcgagctc
aagttagggtctgggaacaggaaggtggtctgcgtcatggtcttccttctcttcatcgct
ttcaactttgggcctgtgagcatcagtgagcctcctccggcttccatctctcctcggatg
agcagaggggagtctcgaccccggagacacttgctggagttctcggcacaagagccagtc
catggagccgagcacccccagcatcccttccaggaccctgaggagccccagcccagccct
acaggccgcccaagtttcaggaacctgacagccttctctggggacgccagggagctgctg
ctgagagacctggaccagctcttcctctcctcggattgccggcacttcaaccgaaccgag
tccctgaggcttgctgacgagctgagtggctgggtccagcgccaccagagaggccggcgg
aaaacaccccagagagcccaggagaaacagaagtctcagctgtggaagaagtcacctcca
gttcaggcagtccccacccgcccccctgggcccccagaaggggattccatgggccagctg
cagctgtaccgccaaccagaccgttcgcagcccgagttcctggatgcaattgaccgacgg
gaagacacattttatgttgtctccttccgaagggatcacttgctgctcccagccatcagc
cacaacaagacctcccggcccaagatgtccctggtgatgcctgccatggcccccaatgag
accctgtcaggccgggggccccctggggactatgaggagatgatgcagatcgagtgtgag
gtcatggataccagagtgattcacatcaagacctccacagtgcccccctcgctacgaaaa
cagccgtcctcaaccccgggcaatgccacaggtggccccttgccagcttctgcagcagcc
agccagggccaccaggccgcccatcagccctctacctcaataatctctgacctctatgac
tcacactga

DBGET integrated database retrieval system