KEGG   Capra hircus (goat): 102171742
Entry
102171742         CDS       T02910                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04668  TNF signaling pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102171742 (TRAF3)
   04668 TNF signaling pathway
    102171742 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102171742 (TRAF3)
   04621 NOD-like receptor signaling pathway
    102171742 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    102171742 (TRAF3)
   04657 IL-17 signaling pathway
    102171742 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102171742 (TRAF3)
   05203 Viral carcinogenesis
    102171742 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102171742 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102171742 (TRAF3)
   05160 Hepatitis C
    102171742 (TRAF3)
   05171 Coronavirus disease - COVID-19
    102171742 (TRAF3)
   05164 Influenza A
    102171742 (TRAF3)
   05162 Measles
    102171742 (TRAF3)
   05168 Herpes simplex virus 1 infection
    102171742 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102171742 (TRAF3)
   05169 Epstein-Barr virus infection
    102171742 (TRAF3)
   05165 Human papillomavirus infection
    102171742 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin MPS2 Spc29 Spc7 Cast Tropomyosin_1 KxDL T3SSipB Fib_alpha FliJ BLOC1_2 DUF1664 GAS DUF3450 SPATA24 LMBR1
Other DBs
NCBI-GeneID: 102171742
NCBI-ProteinID: XP_005695478
UniProt: A0A452G7I5
LinkDB
Position
21
AA seq 568 aa
MEPSKKLDAAGTLPANPPLKLHPERGAGPAVLVPEQGGYKERFVKAVEDKYKCEKCRLVL
CSPKQTECGHRFCETCMGALLSSSSPKCTACQEVIIKDKVFKDNCCKREILALQIFCRNE
GRGCAEQLALGHLLVHLKNDCQFEELPCVRADCKERVLRKDLRDHVEKACKYREATCSHC
KSQVPMVTLQKHEDTECPCVAVPCPHKCGVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagcccagtaagaagctggacgcggccggcaccctgcctgccaaccccccgctgaag
ctgcaccctgagcgtggagccgggccggccgtgctggtccccgagcagggtggctacaag
gagcgcttcgtcaaggccgtggaggacaagtacaagtgcgagaagtgccgcctggtgctc
tgcagccccaagcagacggagtgcgggcaccgcttctgtgagacctgcatgggcgccctg
ctcagctcctccagcccaaaatgtactgcttgtcaagaagtcatcatcaaagacaaggtg
tttaaggataattgctgcaagagggagattctggcccttcagatattctgtcggaacgag
ggccggggctgtgcggagcagctggccctggggcacctgctggtgcatttgaagaatgac
tgccagtttgaggagcttccgtgtgtccgtgccgactgcaaagagagagtgctgaggaag
gacctgcgtgaccacgtggagaaggcctgtaaataccgcgaggccacgtgcagccactgc
aagagccaggtcccgatggtcacgttgcagaaacacgaagatacggagtgtccctgcgtg
gcggtgccctgcccgcacaagtgcggcgtccagaccctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgcggtgcagcacgtc
aacctgctcaaggagtggagcaactccctggagaagaaggtttccttgctgcagaatgaa
agtgtagaaaaaaacaagagcatacagagtctgcacaaccagatatgtagcttcgaaatt
gaaattgagagacagaaggaaatgcttcgaaataatgaatccaaaatcctccatttacag
cgagtcatcgacagccaagcagagaaactgaaggagctcgacaaagagatccggcccttc
cggcagaactgggaggaggcagacagcatgaagagcagcgtggagtccctccagaaccgg
gtgaccgagctggagagcgtggacaagagcgcagggcaggcggcgcgcaacacaggcttg
ctggagtcgcagctgagccggcacgaccagatgctgagcgtgcacgacatccgcctggcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaacggcgtgctcatctgg
aagatccgcgactacaagcggcggaagcaggaggccgtgatgggcaagacgctgtcgctg
tacagccagcccttctacaccggctacttcggctacaagatgtgcgccagggtctacctg
aacggggacggcatgggcaagggcacgcacctctcgctcttcttcgtcatcatgcgcggc
gagtacgacgcgctgctgccctggcccttcaagcagaaagtgacgctcatgctgatggac
caggggtcctcgcggcggcacctgggggatgcgttcaagccggaccccaacagcagcagc
ttcaagaagcccactggggagatgaacatcgcctccgggtgccctgtcttcgtggcccag
actgtgctggagaacgggacgtacatcaaagacgacaccatttttatcaaagtcatagtg
gatacttcggacctgccggacccctga

DBGET integrated database retrieval system