KEGG   Capra hircus (goat): 102171811
Entry
102171811         CDS       T02910                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
chx  Capra hircus (goat)
Pathway
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx05133  Pertussis
chx05135  Yersinia infection
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102171811 (IRF3)
   04621 NOD-like receptor signaling pathway
    102171811 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    102171811 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    102171811 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102171811 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102171811 (IRF3)
   05133 Pertussis
    102171811 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102171811 (IRF3)
   05161 Hepatitis B
    102171811 (IRF3)
   05160 Hepatitis C
    102171811 (IRF3)
   05171 Coronavirus disease - COVID-19
    102171811 (IRF3)
   05164 Influenza A
    102171811 (IRF3)
   05162 Measles
    102171811 (IRF3)
   05168 Herpes simplex virus 1 infection
    102171811 (IRF3)
   05163 Human cytomegalovirus infection
    102171811 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102171811 (IRF3)
   05169 Epstein-Barr virus infection
    102171811 (IRF3)
   05165 Human papillomavirus infection
    102171811 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102171811 (IRF3)
   04131 Membrane trafficking [BR:chx04131]
    102171811 (IRF3)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    102171811 (IRF3)
Membrane trafficking [BR:chx04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    102171811 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 102171811
NCBI-ProteinID: XP_013826927
UniProt: A0A452F2K8
LinkDB
Position
18
AA seq 418 aa
MGTQKPRILPWLISQLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
SGAYTPGKDKPDLPTWKRNFRSALNRKEVLRLAEDHSKDSQDPHKIYEFVNSGVRDIPET
DTAQDNGRHSTSDTQEDIVQKLLSDMDLSPEGGPSNLTMTSENPPQLLLSPESDIPALCP
NSGLSENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPI
RLPDPAASLADKSVTDYVQCVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSC
GHKPDGEVPKDREGGVFNLGPFITDLITFTEGSRRSPLYTLWFCVGQSWPQDQPWIKRLV
MVKVVPMCLRVLVNIARQGGASSLENTVDLHISNSQPLSLTSDQYMAYLQDLAEDMDF
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggaacccaaaagcctcggatactgccctggctgatatctcagctggaccgaggggag
ttggagggcgtggcctggctgggcgagagccgcacgcgtttccgcatcccttggaagcac
ggcttgcggcaggacgcccagcaggaggatttcggcatcttccaggcctgggctgaagcc
agtggtgcctatactcctgggaaggataagcccgacctgcccacatggaagaggaatttc
cggtctgccctgaaccggaaggaagtgttgcgtttagcggaggaccacagcaaggactcc
caagacccgcacaagatctatgagtttgtgaactcaggggtcagggacatccctgagaca
gataccgctcaagacaatggcagacacagtacctctgatacccaggaagacattgtgcag
aagttactgagtgacatggacttgagcccagaaggagggccctcgaatctgactatgacc
tctgagaacccccctcagctcttactgagccccgaatcagacatccctgctctttgccca
aactcgggactctctgaaaaccccctgaagcagctgttggcgaacgaggaagattgggag
ttcgaggtgactgccttctaccggggctgtcaagtcttccagcagactgtcttctgccct
gggggcctgcggctggtgggatcagaagcaggggacaggatgctgcccgggcagccaata
cgactgccggaccccgcagcgtccctagcagacaagagcgtgacagactacgtgcagtgt
gtgctgagctgcctgggcggggggctggccctgtggcgggccgggcagtggctctgcgcc
cagaggctggggcactgccacgtgtactgggccataggcgaggaactcctccccagctgt
ggccacaagcctgacggcgaggtcccgaaggacagggaaggaggtgtgttcaacctgggg
cccttcataacagatctgatcaccttcactgaaggaagcagacgttcaccactctatacc
ctctggttctgtgtggggcagtcatggccccaggaccagccatggatcaagaggcttgtg
atggtcaaggttgtccccatgtgcctcagggttcttgtaaacatagcgcggcaagggggt
gcctcctccctggagaacactgtcgacctgcacatttccaacagccaacccctctctctc
acctcagaccagtacatggcctatctccaggacctggccgaggacatggatttctag

DBGET integrated database retrieval system