KEGG   Capra hircus (goat): 102171917Help
Entry
102171917         CDS       T02910                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
chx  Capra hircus (goat)
Pathway
chx04614  Renin-angiotensin system
chx04924  Renin secretion
chx05142  Chagas disease (American trypanosomiasis)
chx05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    102171917 (ACE)
   04614 Renin-angiotensin system
    102171917 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102171917 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102171917 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:chx01002]
    102171917 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102171917 (ACE)
   04090 CD Molecules [BR:chx04090]
    102171917 (ACE)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102171917 (ACE)
Peptidases [BR:chx01002]
 Metallo Peptidases
  Family M2
   102171917 (ACE)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102171917 (ACE)
CD molecules [BR:chx04090]
 Proteins
  102171917 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 102171917
NCBI-ProteinID: XP_017920815
LinkDB All DBs
Position
19
AA seq 1306 aa AA seqDB search
MGAASGRRWLPLLLPLLLLLLPPPPVILVLDPALQPGNFSADEAGAQIFAASFNSSAEQV
LFQSTAASWAHDTNITEENARRQEEAALLSQEFSEAWGQKAKGLFDPVWQNFTDPTLLRI
IGAVRTLGPANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNILASSR
SYALLLYAWEGWHNAAGIPLKPLYQDFTALSNEAYTQDGFSDTGAYWRSWYDSPTFTEDL
ERLYQQLEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGNMWAQSWENVYDMVVPF
PDKPNLDVTSAMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQHVSLRRGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGHLVDQWRWGVFS
GRTPPSRYNYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSDNLDVRPLL
SYFQPVTQWLEEQNQQNGEVLGWPEYQWRPPTPDNYPEGIDLVSDEAEARKFVEEYDRRS
QVVWNEYAEANWNYNTNISTDNSKLLMEKNLQMANHTVKYGTWARRFDVTNFQNATMKRM
IKKIQDLERAALPVKELEEYNQILVDMETVYSVASVCHKNGTCLRLEPDLTRLMATSRNY
QDLAWAWKSWRDKVGRSILPFFPKYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQ
LFQELQPLYLNLHAYVRRALHHHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPS
APKMDATEAMIKQGWTPLRMFEEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHAS
AWDFFNGKDFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGD
VLALSVSTPTHLHKIGLLSSGDGSYEEDINFLMKMALDKIAFIPFSFLVDQWRWRVFDGS
VTRENYNQEWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQ
ALCQAAGHQGPLYKCDIYQSKEAGKLLADAMKLGFSQPWPEAMRLITGQSNMSAASMMTY
FKPLLDWLVTENGRHGEKLGWPQYNWTPNSARLEGPVVGSGRVNFLGLDLEEQQARVGQW
VLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggtcgccggtggctgccgctgctgctgccgttgctgctgctgctg
ctgccgccgccgcccgtgatcctggtgctggaccccgcgttgcagccggggaacttttcc
gccgacgaggctggggcgcagatcttcgcagccagcttcaactcgagcgccgagcaggtg
ctgttccagagcacggccgccagctgggcgcacgacaccaacatcaccgaggagaacgcg
cggcgccaggaggaagcagccttgctcagccaggagttttcagaggcctggggccagaag
gccaagggtctgtttgacccggtctggcagaactttaccgaccccacgctgctgcgcatc
atcggggcggtgcgcaccctgggccccgccaacctggacctagagaagcggcagaagtac
aactctctgctaagcaacatgagcaggatttactccaccgccaaggtctgcttccccaac
aagactgccccctgctggtccctggacccagagctcaccaacatcctggcttcctcgcga
agctacgccctgctgctgtatgcctgggagggctggcacaacgctgcgggcatcccactg
aagcccctataccaggacttcactgccctcagcaacgaggcctacacgcaggatggcttc
tcagacacaggggcctactggcgctcctggtatgactctcccaccttcacggaggatctg
gaacgcctctaccagcagctggagcccctctacctgaacctccatgcctacgtccggcgt
gcactgcaccgccgatatggggacagatacatcaacctcaggggacccatccccgctcac
ctgctggggaacatgtgggcccagagctgggagaatgtctacgacatggtggtgcccttc
cccgacaagcccaatcttgatgttaccagtgctatggtgcagaagggctggaacgccaca
cacatgttccgggtggcggaggagttcttcacctccctggggctcttgcccatgccaccc
gagttctgggcggaatccatgctggagaagccaagcgacgggcgggaggtggtgtgccac
gcgtccgcctgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc
actatggaccagctgtccacggtccaccacgagatgggccacgtgcagtactacctgcag
tacaaggaccagcacgtctccctgcgccgaggcgccaacccaggcttccacgaggccatc
ggcgatgtgctggccctctccgtctccactcctgcacacctgcacaagatcggcctgctg
gaccaggtcaccaacgacacagagagcgacatcaactacttgttaaagatggcactggaa
aagattgccttcctgccctttggccacttggtggaccagtggcgttggggggtctttagt
gggcgaacccccccttcccgctacaactatgactggtggtatcttcgaaccaagtatcag
gggatctgtcctccggttgtccgaaacgaaacccactttgacgctggagccaagtttcac
gtcccaaatgtgaccccatatatcaggtacttcgtgagctttgtcctgcagttccagttc
cacgaagcgctgtgcaaggaggcaggccaccaaggccccctgcatcagtgtgacatctac
cagtccacccaggcgggggccaagctccgggcgctgctgcaggcaggctcctcacggccc
tggcaggaggtgctgaaggacatggtcggctcagacaacctggacgttaggccgctgctc
agctacttccagccggtcacacagtggctcgaggagcagaaccagcagaacggcgaggtc
ctgggctggccagagtatcagtggcgcccgccaacgcctgacaattacccggagggcatt
gacctggtgtccgacgaggccgaggcccgcaagtttgtggaggaatatgaccggagatcc
caggtggtgtggaatgagtatgccgaggccaactggaactacaacaccaacatcagcacg
gacaacagcaagttgctgatggagaagaacttgcagatggcaaaccacaccgtcaagtat
ggcacctgggccaggaggttcgacgtgaccaacttccagaatgccaccatgaagcggatg
ataaagaagattcaggatctagagcgggcggcactgcccgtcaaggagctggaagagtac
aaccagatcctggtggacatggagaccgtttacagcgtggcctctgtgtgccacaaaaat
ggcacctgcctgcggctcgagcctgatctgaccaggctgatggccacatcccggaattat
caggacctggcctgggcgtggaagagctggcgcgacaaggtggggcggtccatccttccc
ttcttccccaaatatgtggagctcaccaacaaggccgccaggctcaatggctaccaggat
ggcggggactcctggaggtccatgtatgagatgcccttcctagaggaggagctggagcag
ctgttccaagagctgcagccgctctacctgaacctgcatgcctatgtgcgccgggccctg
caccaccactacgggcccgacgtcatcaacctggagggccccatcccagcccacctgctc
gggaacatgtgggcacagagctggtccaacatctatgacttggtggcacccttcccttca
gcccccaagatggatgccacggaggccatgataaagcagggctggacacccctaaggatg
tttgaggaagcagacaatttcttcacttccctggggctgctgcccatgccccccgagttc
tggaacaagtcaatgctggagaagccgaccgatgggcgggaagtggtgtgccacgcctcc
gcctgggatttcttcaatggcaaggactttaggatcaagcagtgcacctcagtgaacatg
gaagacctggtggtggcccaccacgaaatgggccacatacagtacttcatgcagtacaag
gacttgcccgtgaccttccgggagggcgccaaccccggctttcacgaggccattggggac
gtgctggccctctcagtgtccacccccacgcacctgcacaagatcggcctgctgagcagc
ggggacggcagctacgaggaggatatcaactttctgatgaagatggcgcttgacaagatc
gccttcatccccttcagcttcctcgtcgaccagtggcgttggagggtgtttgacggaagt
gtcaccagggagaactacaaccaggagtggtggagcctcaggctgaagtaccagggtgtc
tgtcccccactggccagatctcaagacgactttgacccaggggccaagttccacattcct
gcaagtgtgccttatgtcaggtacttcgtcagcttcgtcatccagttccagttccaccag
gcactgtgtcaggcggcaggccaccagggccccctgtacaagtgtgacatctaccagtcc
aaggaggccgggaagctcctggcggatgccatgaagctgggcttcagtcagccgtggccc
gaagccatgcggctgatcacgggccagtccaacatgtcggctgcctccatgatgacctac
ttcaagccgctgctggactggctcgtgacggagaacgggcggcatggggagaagctgggc
tggcctcagtacaactggacgccaaactcagctcgcctggaaggccccgtcgtgggctcc
ggccgtgtcaacttcctgggcctggacctggaggagcagcaggcccgcgtgggccagtgg
gtgctgctcttcctgggcgtcgccctgctggtggccacgctgggcctcacccagcggctc
ttcagcatccgccaccacagcctccgccggccccaccgcgggccccagttcggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system