KEGG   Capra hircus (goat): 102172114
Entry
102172114         CDS       T02910                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04066  HIF-1 signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04150  mTOR signaling pathway
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04613  Neutrophil extracellular trap formation
chx04650  Natural killer cell mediated cytotoxicity
chx04662  B cell receptor signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04670  Leukocyte transendothelial migration
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04925  Aldosterone synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04931  Insulin resistance
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05140  Leishmaniasis
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05214  Glioma
chx05223  Non-small cell lung cancer
chx05225  Hepatocellular carcinoma
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172114 (PRKCB)
   04012 ErbB signaling pathway
    102172114 (PRKCB)
   04014 Ras signaling pathway
    102172114 (PRKCB)
   04015 Rap1 signaling pathway
    102172114 (PRKCB)
   04310 Wnt signaling pathway
    102172114 (PRKCB)
   04370 VEGF signaling pathway
    102172114 (PRKCB)
   04064 NF-kappa B signaling pathway
    102172114 (PRKCB)
   04066 HIF-1 signaling pathway
    102172114 (PRKCB)
   04020 Calcium signaling pathway
    102172114 (PRKCB)
   04070 Phosphatidylinositol signaling system
    102172114 (PRKCB)
   04071 Sphingolipid signaling pathway
    102172114 (PRKCB)
   04150 mTOR signaling pathway
    102172114 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102172114 (PRKCB)
   04540 Gap junction
    102172114 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102172114 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    102172114 (PRKCB)
   04662 B cell receptor signaling pathway
    102172114 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    102172114 (PRKCB)
   04670 Leukocyte transendothelial migration
    102172114 (PRKCB)
   04062 Chemokine signaling pathway
    102172114 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    102172114 (PRKCB)
   04929 GnRH secretion
    102172114 (PRKCB)
   04912 GnRH signaling pathway
    102172114 (PRKCB)
   04921 Oxytocin signaling pathway
    102172114 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    102172114 (PRKCB)
   04918 Thyroid hormone synthesis
    102172114 (PRKCB)
   04919 Thyroid hormone signaling pathway
    102172114 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    102172114 (PRKCB)
   04916 Melanogenesis
    102172114 (PRKCB)
   04925 Aldosterone synthesis and secretion
    102172114 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102172114 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    102172114 (PRKCB)
   04971 Gastric acid secretion
    102172114 (PRKCB)
   04972 Pancreatic secretion
    102172114 (PRKCB)
   04973 Carbohydrate digestion and absorption
    102172114 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102172114 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102172114 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102172114 (PRKCB)
   04727 GABAergic synapse
    102172114 (PRKCB)
   04725 Cholinergic synapse
    102172114 (PRKCB)
   04728 Dopaminergic synapse
    102172114 (PRKCB)
   04726 Serotonergic synapse
    102172114 (PRKCB)
   04720 Long-term potentiation
    102172114 (PRKCB)
   04730 Long-term depression
    102172114 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    102172114 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102172114 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102172114 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102172114 (PRKCB)
   05206 MicroRNAs in cancer
    102172114 (PRKCB)
   05205 Proteoglycans in cancer
    102172114 (PRKCB)
   05231 Choline metabolism in cancer
    102172114 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102172114 (PRKCB)
   05214 Glioma
    102172114 (PRKCB)
   05223 Non-small cell lung cancer
    102172114 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102172114 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    102172114 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102172114 (PRKCB)
   05032 Morphine addiction
    102172114 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102172114 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102172114 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102172114 (PRKCB)
   05161 Hepatitis B
    102172114 (PRKCB)
   05171 Coronavirus disease - COVID-19
    102172114 (PRKCB)
   05164 Influenza A
    102172114 (PRKCB)
   05163 Human cytomegalovirus infection
    102172114 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102172114 (PRKCB)
   05140 Leishmaniasis
    102172114 (PRKCB)
   05143 African trypanosomiasis
    102172114 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102172114 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102172114 (PRKCB)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102172114 (PRKCB)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102172114 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 102172114
NCBI-ProteinID: XP_005697667
LinkDB
Position
25
AA seq 671 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGPGPKTPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggccgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
ggaaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcgctgccatgaa
tttgtcaccttctcctgcccgggcgctgacaagggcccagcctctgacgacccccggagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgatcactgcgggtca
ctgctctatggacttatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacggaccacacggagcgccgcggc
cgcatctacatccaagcccacatcgagagggaggtcctcattgttgtcgtaagagatgct
aaaaaccttgtacctatggatcctaatggcttgtcagatccttacgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcagaagaccaagaccatcaaatgctccctcaac
cccgagtggaacgagacatttagattccagctgaaagaatcagacaaagacaggagactg
tctgtagagatttgggactgggatctgaccagcagaaatgacttcatgggatctttgtcg
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaaattactgagccag
gaggaaggcgagtacttcaacgtgcctgtgcccccggaaggcagtgagggcaacgaggag
ctgcgacagaaattcgagagagccaagatcggtcctgggcccaagactcccgaagaaaag
acgaccaacaccatctccaaatttgacaacaacggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cgaaaaggcacagatgagctgtatgccgtgaagatcctgaagaaggacgtggtcatccaa
gatgatgacgtggaatgcacaatggtggagaagcgggtgctggccctgccagggaagccg
cccttcctgacccagctgcattcctgcttccagaccatggatcgcctgtacttcgtgatg
gagtatgtgaacggcggtgacctcatgtaccacatccagcaagtaggccggttcaaggag
cctcacgccgtattttacgctgcagaaattgccatcggtctgttcttcttgcagagcaag
ggcatcatttaccgtgacctgaaacttgacaatgtgatgctggattccgagggccacatc
aagatcgctgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagacc
ttctgcggcaccccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggcgtcctgctgtatgaaatgttggctgggcaggcaccg
tttgaaggggaggatgaggatgaactcttccagtcgatcatggaacacaacgtggcttat
ccgaagtccatgtccaaagaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcatgcgtttttc
cggtatattgactgggagaaacttgaacgcaaagagattcagcccccatataagccgaaa
gccagagacaagcgagacacctccaatttcgacaaagagttcaccagacagcctgtggaa
ctcacgcctactgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcctatactaacccagagtttgtcattaatgtgtag

KEGG   Capra hircus (goat): 102175984
Entry
102175984         CDS       T02910                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04066  HIF-1 signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04150  mTOR signaling pathway
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04613  Neutrophil extracellular trap formation
chx04650  Natural killer cell mediated cytotoxicity
chx04666  Fc gamma R-mediated phagocytosis
chx04670  Leukocyte transendothelial migration
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04925  Aldosterone synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05214  Glioma
chx05223  Non-small cell lung cancer
chx05225  Hepatocellular carcinoma
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102175984 (PRKCG)
   04012 ErbB signaling pathway
    102175984 (PRKCG)
   04014 Ras signaling pathway
    102175984 (PRKCG)
   04015 Rap1 signaling pathway
    102175984 (PRKCG)
   04310 Wnt signaling pathway
    102175984 (PRKCG)
   04370 VEGF signaling pathway
    102175984 (PRKCG)
   04066 HIF-1 signaling pathway
    102175984 (PRKCG)
   04020 Calcium signaling pathway
    102175984 (PRKCG)
   04070 Phosphatidylinositol signaling system
    102175984 (PRKCG)
   04071 Sphingolipid signaling pathway
    102175984 (PRKCG)
   04150 mTOR signaling pathway
    102175984 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102175984 (PRKCG)
   04540 Gap junction
    102175984 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102175984 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    102175984 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    102175984 (PRKCG)
   04670 Leukocyte transendothelial migration
    102175984 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    102175984 (PRKCG)
   04929 GnRH secretion
    102175984 (PRKCG)
   04921 Oxytocin signaling pathway
    102175984 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    102175984 (PRKCG)
   04918 Thyroid hormone synthesis
    102175984 (PRKCG)
   04919 Thyroid hormone signaling pathway
    102175984 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    102175984 (PRKCG)
   04916 Melanogenesis
    102175984 (PRKCG)
   04925 Aldosterone synthesis and secretion
    102175984 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102175984 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    102175984 (PRKCG)
   04971 Gastric acid secretion
    102175984 (PRKCG)
   04972 Pancreatic secretion
    102175984 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102175984 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102175984 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    102175984 (PRKCG)
   04727 GABAergic synapse
    102175984 (PRKCG)
   04725 Cholinergic synapse
    102175984 (PRKCG)
   04728 Dopaminergic synapse
    102175984 (PRKCG)
   04726 Serotonergic synapse
    102175984 (PRKCG)
   04720 Long-term potentiation
    102175984 (PRKCG)
   04730 Long-term depression
    102175984 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    102175984 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102175984 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102175984 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102175984 (PRKCG)
   05206 MicroRNAs in cancer
    102175984 (PRKCG)
   05205 Proteoglycans in cancer
    102175984 (PRKCG)
   05231 Choline metabolism in cancer
    102175984 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102175984 (PRKCG)
   05214 Glioma
    102175984 (PRKCG)
   05223 Non-small cell lung cancer
    102175984 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102175984 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    102175984 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    102175984 (PRKCG)
   05032 Morphine addiction
    102175984 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102175984 (PRKCG)
   05161 Hepatitis B
    102175984 (PRKCG)
   05171 Coronavirus disease - COVID-19
    102175984 (PRKCG)
   05163 Human cytomegalovirus infection
    102175984 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102175984 (PRKCG)
   05143 African trypanosomiasis
    102175984 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102175984 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102175984 (PRKCG)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102175984 (PRKCG)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102175984 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 102175984
NCBI-ProteinID: XP_017918524
LinkDB
Position
18
AA seq 697 aa
MSGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCNLLQ
KFEACNYPLELYERVRTGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWDRLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQAEFQGFTYVNPDFVHPDARSPISPTPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtccggcctgggccccggcggaggcgattcagagggcggaccccggcccctgttttgc
agaaagggggctttgaggcagaaggtggtccatgaggtcaagagccacaagttcaccgct
cgtttcttcaagcagccgaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggtctgcagtgtcaagtctgcagttttgtggttcatcgacgatgccacgagttt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgatccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctccctg
ctctacgggctggtgcaccagggcatgaagtgttcttgctgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggcgtggaccacacggagcgccgggggcgc
ctgcagctggagatccgggcgcccacttccgatgagatccacgttacggttggcgaggcc
cggaacctcatcccaatggaccccaatggtctctccgatccctatgtgaagctgaagctc
atcccagaccctcggaatttgaccaaacagaagacccgcacggtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccgggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgaaacgacttcatgggcgccatgtcc
ttcggcgtctcggagctgctcaaggcgcccgtggacggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggctgacgccgacaactgcaacctcctccag
aagttcgaggcctgtaactaccccttggaactatacgagagggtgcggacgggtccctct
tcgtctcctatcccctccccatcccccagtcccaccgactccaagcgctgtttttttggg
gccagccctggacgactgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgccggggctccgatgagctctacgccatcaag
atcctgaagaaagacgtgatcgtccaggatgacgatgtggactgcaccctggtggagaaa
cgtgtgctggccctggggggccgaggccccggaggccggccgcacttcctcacccagctt
cactccaccttccagaccccggatcgcctgtattttgtgatggagtatgtcaccgggggc
gacttgatgtaccacattcaacagctgggcaagtttaaggaaccccacgcagcgttctac
gccgcagaaatcgccatcggcctcttcttcctccataaccagggcattatctatcgggat
ctgaaactggacaatgtgatgctggatgccgaagggcacatcaaaatcaccgacttcggc
atgtgtaaggagaacgtctttcccgggagcaccacgcgcaccttctgcgggaccccggac
tacatagcccccgagatcattgcctaccaaccctatgggaagtctgttgattggtggtcc
tttggggttctgctctacgagatgttggcgggacagcccccctttgatggagaagacgag
gaggagctgtttcaggcgatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagctgtggccatctgcaaggggttcctcaccaagcacccggccaagcgcctgggctca
ggccccgatggagagcccaccatccgtgctcatggctttttccgctggatcgactgggac
aggctggaacgattagagatcgcgcctccgttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcactcgggcggccccggcgctgacaccccctgaccgcctg
gttctggccagcatcgaccaggccgagttccagggcttcacctatgtcaaccccgatttc
gtgcatccggatgcccgcagccctatcagcccaacgcctgtgccagtcatgtaa

KEGG   Capra hircus (goat): 102180890
Entry
102180890         CDS       T02910                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04066  HIF-1 signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04613  Neutrophil extracellular trap formation
chx04650  Natural killer cell mediated cytotoxicity
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04670  Leukocyte transendothelial migration
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx04960  Aldosterone-regulated sodium reabsorption
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05214  Glioma
chx05223  Non-small cell lung cancer
chx05225  Hepatocellular carcinoma
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102180890 (PRKCA)
   04012 ErbB signaling pathway
    102180890 (PRKCA)
   04014 Ras signaling pathway
    102180890 (PRKCA)
   04015 Rap1 signaling pathway
    102180890 (PRKCA)
   04310 Wnt signaling pathway
    102180890 (PRKCA)
   04370 VEGF signaling pathway
    102180890 (PRKCA)
   04066 HIF-1 signaling pathway
    102180890 (PRKCA)
   04020 Calcium signaling pathway
    102180890 (PRKCA)
   04070 Phosphatidylinositol signaling system
    102180890 (PRKCA)
   04072 Phospholipase D signaling pathway
    102180890 (PRKCA)
   04071 Sphingolipid signaling pathway
    102180890 (PRKCA)
   04151 PI3K-Akt signaling pathway
    102180890 (PRKCA)
   04150 mTOR signaling pathway
    102180890 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102180890 (PRKCA)
   04540 Gap junction
    102180890 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102180890 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    102180890 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    102180890 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    102180890 (PRKCA)
   04670 Leukocyte transendothelial migration
    102180890 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    102180890 (PRKCA)
   04929 GnRH secretion
    102180890 (PRKCA)
   04912 GnRH signaling pathway
    102180890 (PRKCA)
   04921 Oxytocin signaling pathway
    102180890 (PRKCA)
   04926 Relaxin signaling pathway
    102180890 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    102180890 (PRKCA)
   04918 Thyroid hormone synthesis
    102180890 (PRKCA)
   04919 Thyroid hormone signaling pathway
    102180890 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    102180890 (PRKCA)
   04916 Melanogenesis
    102180890 (PRKCA)
   04925 Aldosterone synthesis and secretion
    102180890 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102180890 (PRKCA)
   04270 Vascular smooth muscle contraction
    102180890 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    102180890 (PRKCA)
   04971 Gastric acid secretion
    102180890 (PRKCA)
   04972 Pancreatic secretion
    102180890 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102180890 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102180890 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102180890 (PRKCA)
   04727 GABAergic synapse
    102180890 (PRKCA)
   04725 Cholinergic synapse
    102180890 (PRKCA)
   04728 Dopaminergic synapse
    102180890 (PRKCA)
   04726 Serotonergic synapse
    102180890 (PRKCA)
   04720 Long-term potentiation
    102180890 (PRKCA)
   04730 Long-term depression
    102180890 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    102180890 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102180890 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    102180890 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102180890 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102180890 (PRKCA)
   05206 MicroRNAs in cancer
    102180890 (PRKCA)
   05205 Proteoglycans in cancer
    102180890 (PRKCA)
   05231 Choline metabolism in cancer
    102180890 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102180890 (PRKCA)
   05214 Glioma
    102180890 (PRKCA)
   05223 Non-small cell lung cancer
    102180890 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102180890 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    102180890 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102180890 (PRKCA)
   05032 Morphine addiction
    102180890 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102180890 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102180890 (PRKCA)
   05161 Hepatitis B
    102180890 (PRKCA)
   05171 Coronavirus disease - COVID-19
    102180890 (PRKCA)
   05164 Influenza A
    102180890 (PRKCA)
   05163 Human cytomegalovirus infection
    102180890 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102180890 (PRKCA)
   05143 African trypanosomiasis
    102180890 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102180890 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102180890 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102180890 (PRKCA)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102180890 (PRKCA)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102180890 (PRKCA)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102180890 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 102180890
NCBI-ProteinID: XP_017919460
LinkDB
Position
19
AA seq 672 aa
MADVFPAAEPAAPQDVANRFARKGALRQKNVHEVKNHRFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNETFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGRFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgtcttcccggccgccgagccggcggcgccgcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaagaaccaccgcttcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttactttttcttgtccgggggcggataaaggacccgacacggatgacccgaggagc
aagcacaagttcaagatccacacatatggcagccccaccttctgcgaccactgcgggtcc
ctgctctacggcctcatccaccaggggatgaagtgtgacacctgtgacatgaacgtgcac
aagcagtgtgtgatcaacgtgcccagcctctgtggcatggaccacacggagaagaggggc
cgcatctacctgaaggccgaggtcacggatgaaaagctgcacgtcacagtacgagatgcg
aaaaacctaatccctatggatccaaatgggctttcagatccctatgtgaagctgaagctt
attcctgaccccaagaacgagagcaaacaaaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagaccttcacgttcaaattaaaaccttctgataaagaccggcggctg
tccgtggagatctgggactgggatcgaactacacggaacgacttcatggggtccctttcc
tttggggtctcggagctgatgaagatgccggccagtggatggtacaagctgctgaaccaa
gaggagggtgagtactacaacgtgccgatccccgaaggcgacgaggaaggcaacgtggag
ctcaggcagaaattcgagaaagccaagcttggccccgctggcaacaaagtcatcagtccc
tccgaggacaggagacagccttccaacaacctggacagggtgaagctcaccgacttcaac
ttcctcatggtgctgggcaaaggcagctttggcaaggtgatgctggccgaccggaagggg
accgaggagctgtacgccatcaagatcctgaagaaagacgtggtcatccaggacgacgac
gtggaatgcaccatggtggagaagcgggtgctggccctgctggacaagccgccgttcctg
acgcagctgcactcctgcttccagacggtggaccggctctacttcgtcatggagtacgtc
aacggcggggacctcatgtaccacatccagcaggtcgggaggttcaaggagccgcaagca
gtgttctatgcagcagagatttccatcgggctgttcttccttcataaaagaggaatcatt
tatcgggacctgaagttagacaacgtcatgctggactcggaaggacacatcaagatcgcg
gacttcgggatgtgcaaggagcacatgatggacggcgtcacgaccaggaccttctgtggg
acccccgactacatcgccccggagataatcgcctatcagccgtatgggaagtccgtggac
tggtgggcctatggcgtcctgttgtacgagatgttggccgggcagcctccgttcgacggc
gaggacgaggatgagctgttccagtccatcatggagcacaacgtctcgtaccccaagtcc
ttgtccaaggaggccgtgtccatctgcaaagggctgatgaccaagcaccctgggaagcgg
ctgggctgcgggcccgagggcgagcgggatgtgcgggagcacgccttcttccggaggatc
gactgggagaagctggagaaccgtgagatccagccacccttcaagcccaaagtgtgcggc
aaaggagcagagaactttgacaagttcttcacgcgaggacagcctgtcttgacgccgccc
gaccagctggtcatcgctaacatcgaccagtctgatttcgaaggcttctcgtacgtcaac
ccccagttcgtgcaccccatcctgcagagcgcggtatga

DBGET integrated database retrieval system