KEGG   Capra hircus (goat): 102172197
Entry
102172197         CDS       T02910                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor
  KO
K06503  transferrin receptor
Organism
chx  Capra hircus (goat)
Pathway
chx04066  HIF-1 signaling pathway
chx04144  Endocytosis
chx04145  Phagosome
chx04216  Ferroptosis
chx04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102172197 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102172197 (TFRC)
   04145 Phagosome
    102172197 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    102172197 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102172197 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:chx01002]
    102172197 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102172197 (TFRC)
   04090 CD molecules [BR:chx04090]
    102172197 (TFRC)
Peptidases and inhibitors [BR:chx01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   102172197 (TFRC)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102172197 (TFRC)
  Exosomal proteins of colorectal cancer cells
   102172197 (TFRC)
CD molecules [BR:chx04090]
 Proteins
  102172197 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer Prominin
Other DBs
NCBI-GeneID: 102172197
NCBI-ProteinID: XP_013818924
UniProt: A0A452GAA0
LinkDB
Position
1
AA seq 770 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENVDSNMRGNQTSIT
KPKRLNGYICYGIIAVIIFFLIGFMIGYLGYCKRVEPQGDCGKEAGTQPSCPEETEAFEP
EEQLPGVPRIFWADLKSTLSDRLDAVDFTRAIKMLNENSYVPREAGSQKDSSLAFYIESQ
LRDYKLDKVWHDEHFVKIQVKGSSQNSVSIVSTSGDGSQAYSVENPEGYVAYSKAATVTG
KLVHANFGTKQDFEDLNMPVNGSLVIVRAGKITFAEKVANAERLNAIGVLIYMDHSKFPI
VNANLPVFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAGAERLFQNMQ
GDCPSTWGTDSSCKLVSSQDKNVKLSVNNVLKEIRIFNVFGVIKGFEELDRYIIVGAQRD
AWGPGAAKSSVGTSLLLTLARILSDMVLKGQFKPSRSIVFASWSGGDFGAVGATEWLEGY
LSSLHLKAFTYINLDKAVVGTTNFKVSASPLLYSLIEKIMKDVKHPLTGLSLYRDSNWIS
KVKKLSLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLDTPMDTYETLNGQVPQLNRVARAA
AEVAGQLVMKLTHGVELDLNYEMYNDEILRFVKEMNLFRADIRDMGLNMQWLYSARGDFF
RATSRLTTDYKNAEKTDRSVMREINDRIMKVEYHLLSPYVSPREFPFRHIFWGSGSHTLS
ALLEHLKLRKKLNGAFNQTLLENQLALATWTIQGAANALSGDIWDIDNEF
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaacttgtttggtggagaaccattgtcatat
accaggtttagtctggctcggcaagtagatggtgataacagtcatgtggagatgaaatta
gctgcggatgaagaagaaaatgttgacagtaacatgaggggtaaccaaaccagtatcaca
aaaccgaaaaggttaaatggatatatctgctacgggatcattgctgtaatcatctttttc
ttgattggatttatgattggctacttgggctattgtaaacgtgtggaaccacaaggtgat
tgtgggaaagaggcaggaacacagccttcatgcccagaggagacagaagctttcgaaccc
gaagagcagctccctggagtgcctcgcatattctgggcagacctcaaatcaacgctgtca
gacagactggatgccgtagactttaccagggccatcaagatgctgaatgaaaattcttat
gtcccacgtgaggctggatctcaaaaagatagcagtttggctttttatattgaaagtcaa
ttacgtgactataaactcgacaaagtctggcatgatgaacattttgttaagattcaggtc
aaaggcagttctcaaaactcggtgtctatagtgagtacaagtggtgacggcagtcaggca
tactcagtggagaatcctgagggttacgtggcatatagtaaggctgcgacagttactggc
aaactggtccatgctaattttggcactaaacaggactttgaggatttaaatatgcctgtg
aatggatctttagtgattgtaagagctggaaaaatcacttttgctgaaaaggtggcaaat
gctgaacgtttaaatgcaattggtgtcttgatatacatggaccatagtaaatttcccatt
gttaacgcaaatcttccagtgtttggacatgctcatctgggaacaggtgacccttacaca
cctggattcccttcttttaatcacactcaatttccaccatctcagtcatcaggattgcca
aacatacctgtccaaacaatttccagagccggtgcagaaaggctatttcaaaatatgcaa
ggagattgtcctagcacttggggaacagactcttcatgtaagctggtatcatcacaggat
aaaaatgtgaaacttagtgtgaacaatgtgctgaaggagataagaatttttaacgtcttt
ggagttattaagggctttgaagaactagatcgctatattatagtaggggcccagagggat
gcctggggtcctggagctgcaaagtccagtgtaggaacaagtctgctattgacacttgcc
cggatactttccgatatggtcttaaaaggtcagtttaaacccagcagaagcattgtcttt
gccagctggagtggtggagactttggagctgttggtgccactgaatggctagagggatac
ctttcctcattgcatttaaaggctttcacttatattaatctggataaagctgttgttggt
actaccaatttcaaagtttctgccagtccgctgttgtattcacttattgagaagatcatg
aaagatgtgaaacatccacttactgggctgtctctgtatcgggacagcaactggatcagc
aaagtgaagaaactttctttggataatgctgctttccctttccttgcgtattctggaatc
ccagcagtctctttctgtttttgtgaggacacagattacccttatttagacactcccatg
gacacctatgagacattgaacggacaagttcctcagctgaacagagtggcacgtgcagca
gcagaagtggctggccagcttgtgatgaaacttacccatggtgtcgagctggacctgaac
tatgagatgtataatgacgaaatacttcgttttgtgaaggaaatgaacctattcagagca
gacataagggatatgggtctgaatatgcagtggctgtattctgctcgtggagacttcttc
cgtgctacatctagactaactacggattataagaatgctgagaaaacagacagatctgtg
atgagggaaatcaatgaccgtatcatgaaagtggaatatcacctcctctcaccctatgtg
tctccaagagagtttcctttccgacacatcttctggggctctggctctcacactctgtca
gctttactggagcacttgaagctgcgtaagaaacttaatggtgcttttaatcaaacactg
ttggaaaaccagttggctctggcaacttggactattcagggagctgcaaatgccctctct
ggagacatctgggacattgacaacgaattttaa

DBGET integrated database retrieval system