KEGG   Capra hircus (goat): 102172327
Entry
102172327         CDS       T02910                                 

Gene name
DUSP6
Definition
(RefSeq) dual specificity phosphatase 6
  KO
K21946  dual specificity phosphatase 6 [EC:3.1.3.16 3.1.3.48]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172327 (DUSP6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102172327 (DUSP6)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102172327 (DUSP6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102172327 (DUSP6)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102172327 (DUSP6)
    3.1.3.48  protein-tyrosine-phosphatase
     102172327 (DUSP6)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    102172327 (DUSP6)
SSDB
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT PTPlike_phytase
Other DBs
NCBI-GeneID: 102172327
NCBI-ProteinID: XP_017903099
UniProt: A0A452E7K9
LinkDB
Position
5
AA seq 381 aa
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPLRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPTQ
QLYFTTPSNQNVYQVDSLQST
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgatagatacgctcagacccgtgcccttcgcgtcggaaatggcgatcagcaagacggtg
gcgtggctcaacgagcagctggagctgggtaacgagcggctgctgttgatggactgccgg
ccgcaggagctgtacgagtcgtcccatatcgagtccgccatcaacgtggccatcccgggg
atcatgctgcggcgcctgcagaagggcaacctgccgctgcgcgcgctattcacgcgcggc
gaggaccgggaccgcttcacccggcgctgcggcaccgataccgtggtgctctacgacgag
agcagcagcgactggaacgagaatacgggcggcgagtcggtgctcgggctgctgctcaag
aagctcaaggacgagggatgccgggcgttctacctggaaggtggtttcagtaagttccaa
gccgagttcgccctgcactgcgagactaatctagacggctcgtgtagcagcagctcgcca
ccgttgccagtactggggctcgggggcctgcggatcagctccgactcctcctcggacatt
gagtctgaccttgaccgagaccccaatagtgcaacggactcggatggcagcccgctgtcc
aacagtcagccttctttccctgtggagatcttgcccttcctctatttggggtgtgccaag
gactccaccaacctggacgtgttggaggagtttggcatcaagtacatcttgaacgtcacc
cccaacttgccgaatctctttgagaatgcaggagagttcaaatacaagcagatccccatc
tcggatcactggagccaaaacctgtcccagtttttccctgaggccatttctttcatagat
gaagcccggggcaaaaactgtggcgtcctggtgcattgcttagctggcatcagccgctcg
gtcactgtgactgtggcttaccttatgcagaagctcaatctgtcaatgaatgatgcttat
gacattgtgaagatgaagaaatccaacatctctcccaacttcaacttcatgggccagctc
ctggacttcgagaggacgctgggactgagcagcccctgtgacaaccgcgtccccacacag
cagctctatttcaccacgccctccaaccagaatgtctaccaggtggactctctgcaatcc
acgtga

DBGET integrated database retrieval system