KEGG   Capra hircus (goat): 102172481
Entry
102172481         CDS       T02910                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04371  Apelin signaling pathway
chx04611  Platelet activation
chx04725  Cholinergic synapse
chx04921  Oxytocin signaling pathway
chx05145  Toxoplasmosis
chx05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102172481 (PIK3R6)
   04072 Phospholipase D signaling pathway
    102172481 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    102172481 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    102172481 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102172481 (PIK3R6)
   04062 Chemokine signaling pathway
    102172481 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102172481 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102172481 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    102172481 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102172481 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102172481 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102172481 (PIK3R6)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102172481 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 102172481
NCBI-ProteinID: XP_017920128
LinkDB
Position
19
AA seq 756 aa
MESSDVELDLQRSVQAVLRELSAQAPALQSNRGMWRWSLHKKVERDPRKSPVLVRILLRE
LEKAESEDARHIIIPLLHTLMYVLTKATGITEELHRRTYAFCMRLLTLPAPYCTIALDCA
IRLKTETAVPGTLYQRLVIAEQNLTSELYPYRERVFLFVDPELVSPSVCSALLLEIEAAQ
GQQTPEACMRHVISHALQAALGAACHAGALQRKLLASSRPALEGYFHAVVTAVEQMAREP
SPSREGHLERLEEIYCSLLGPPPAARGRCGGDPLQDRALSVPLPSPRITFHLWTDEEQLW
KELVLFLRPLTQLRLSADLEALDLQGLLPDWELARASMLSTDSGIVRDLPLAADELLTPG
SPEAERAGLQRKGGIKKRVWPADIMMPSSWDGPLGLHRRTGRPSGDGELLPGISRLHTAR
VLVLGDDRMLGRLARAYCNLRKREAQRFCLTPRLSLQLYYIPLLAPETSAASRRSELGEL
AAFLGRADPWYESIINTLCPTIHKLAEMPLSLDTSQTVDPFILDAITYYVRMGTQPVYFQ
IYTVKIFSGDLSQDPAEDIFLTELKVKIQDSKFPKDSFSPRRRGVAEGPGAELSICYQKA
LLSHRNQEVTVSLRATGLVLKTLPASDTEVSGPIYCTPTAAPDTDHTCLRVSVTEIVKTS
NLAGRSFSVVTNTFRTTNIQIQSQDRRLLTLSLDKDSCRTYRDVVRFEVAPCPEPCSRTQ
QSKVLGLSSHQQEMERNKAKAKPLLIPINTFSGIVQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggatctccagcggagcgtgcaggctgtgctccgagag
ctcagcgcccaggcccccgccctgcagagcaaccgaggcatgtggaggtggtccctgcac
aagaaggttgagcgggatcctaggaagagcccggtgctggtccgcatcctgctcagagag
ctggagaaggcagaaagtgaggacgcccgccacatcatcattcccttgctgcacactcta
atgtacgtgctcactaaggccacgggcatcacagaggagctccaccggagaacatacgcc
ttttgcatgaggttgctgaccctgcctgccccctactgcacgatcgccctggactgtgcc
atcaggctgaaaacagagacggccgtcccagggacgctgtaccagaggctggtcattgcc
gagcagaacctgacaagcgagctgtacccctaccgggagagagtgttcctcttcgtggat
cctgagctggtgtctccctccgtgtgcagtgccctgctgctggagattgaggcggcccag
gggcagcagacgccggaggcctgcatgcgccacgtgatctcccacgccctgcaggcggca
ctgggggcggcctgccacgcaggcgcgctgcaaaggaagctgctggccagctcccgcccc
gccctggagggctatttccacgccgtggtgacagcagtggagcagatggccagagagccc
agccctagccgagagggccacctggagaggctggaggagatttactgctcgctgctgggg
ccgccgccggccgccagggggcgctgcggcggtgaccccctccaggaccgggcgctgagt
gtccctctgcccagcccccgcatcaccttccacctgtggactgacgaggagcagctctgg
aaggaactggtgctcttcctgcgcccgctaacccagctgcgcctcagtgcagacttggag
gccttggatcttcagggcctcctgccagactgggagttggcccgggcatccatgctgtcc
accgacagtggcatcgtgcgggaccttccactggcggccgacgagctgctgacacctggc
agccccgaggcagagcgagccgggctgcagcgcaaggggggcatcaagaagcgggtgtgg
cccgcggacatcatgatgcccagcagctgggatgggcccctggggctgcaccggaggact
ggcagacccagcggggatggggagctgctgcccggcatctcccggctgcacacagcacgg
gtactggtgctgggggatgacaggatgctggggcgcctggcccgggcctactgcaacctc
aggaagcgagaggcccagaggttctgcctcacccctcgactcagcctgcagctctactac
atacccctgctggcgcccgagacgtctgcagcatccaggcgttcggagctgggagagttg
gccgctttcctgggccgcgcggacccgtggtacgagagcatcatcaacaccctgtgcccc
accatccacaagctggcagagatgcctctctccctggacacatcccagaccgtagacccc
ttcatcctagatgccatcacctactatgttcgcatgggcacccagcctgtctatttccag
atctacacggtcaagatcttctctggtgacctgagccaagaccctgccgaggacattttc
ctcaccgagctcaaggtcaagatccaagactccaagttccccaaagatagtttttcaccc
cggaggagaggcgtggctgagggtccaggggctgagctctccatctgctaccagaaggcc
ctgctcagccaccggaaccaggaggtcaccgtctccctgcgggccactgggctggtcctg
aagacccttccagccagtgacactgaagtttcagggcccatctactgcacccccactgct
gcgcccgacacagaccacacgtgcctgagagttagtgtgacagagattgtgaagacctcc
aacttggcgggaaggtccttctctgtggtgacaaacaccttccggacaaccaacatccag
atccagagccaggaccggaggctgctgaccctgtcactggacaaggacagctgccgcacg
tacagggatgtggtcaggtttgaggttgctccctgtccagagccgtgttccaggacccag
caatccaaggtgctggggctcagctcccaccagcaggagatggaaaggaacaaagccaag
gctaagcctctgctgatacccatcaacacgttctctggcatcgtccagtga

KEGG   Capra hircus (goat): 102172758
Entry
102172758         CDS       T02910                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
chx  Capra hircus (goat)
Pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04371  Apelin signaling pathway
chx04611  Platelet activation
chx04725  Cholinergic synapse
chx04921  Oxytocin signaling pathway
chx05145  Toxoplasmosis
chx05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102172758 (PIK3R5)
   04072 Phospholipase D signaling pathway
    102172758 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    102172758 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    102172758 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102172758 (PIK3R5)
   04062 Chemokine signaling pathway
    102172758 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102172758 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102172758 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    102172758 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102172758 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102172758 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102172758 (PIK3R5)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102172758 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 BUD22 Sporozoite_P67 Calici_MSP
Other DBs
NCBI-GeneID: 102172758
NCBI-ProteinID: XP_017920131
LinkDB
Position
19
AA seq 889 aa
MQQGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTLLCTPHFPPDSDLLLKASRTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLSTRSHRSSTVTVLLLNPLEVQAEFLAVAN
QLSTPGPSPHSTYTTLLLHAFQATFGPHCDLPGLHCRLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFPGVLDTAKPGKLRTIPMPVARCYTYSWNQDSFDI
LQEILLKEQELLQPGILGDDEDEDGEEEDEDEDEEEEDLDSDRHSAERDSLLSTSSAASR
DSTLSLASSQASGPTLHRQLLTSFVSGLSDGMDSGYVEDSEESSFERPKRPGSQERRGHR
RSGQKFNRIYKLFKSTSQLVLRRDSRALEGCPDSALPLRRAGSLCSPVSPLDGPRPASRA
QRSRSLPQAKLSPPLPGWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVAR
AYSKLRRLESNRPLLTRFFKLQFFYVPVKRSQGTGGCTSPASPCQTSSLPADSPRHPSPA
ELGTAPWGESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSPAQLP
ILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGS
KRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNMEKVCTSVNLSKACRQQEELDSSTEAL
MLNLTEVVKRQNPKSKKGFNQITTSQVKVDKVQIIGSNTCPFAVCLDQDERKILQSVVRC
EVSPCYKPEKSNLCPQPQRPSHPPAQGQTTPDLCSLLCLPIMTFSGALP
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgcagcaaggggccacgacatgcacggaggaccgcatccagcacgccctggagcgctgc
ttgcatgggctcagcctcagccgccgctccacctcctggtcagctgggttgtgtctgaac
tgctggagcctgcaagagctggtgagcagggacccgggccacttccttatcctcctggag
cagatcctgcagaagacccgagaggtccaagagaagggcacctatgacctcctggccccc
ctagccctgctgttctactccactctcctctgtacaccacacttcccgccagactcagac
ctccttctgaaagcatccagaacctaccaccgattcctgacctggcccgttccttactgc
agcatctgccaggaactgctcaccttcatcgatgctgaactgaaggccccaggaatctcc
taccagcgcctggtgagggccgagcagggcctgtccactaggagtcaccgcagctccact
gtcactgtgctcttgctgaacccattggaggtgcaggccgagttccttgccgtggccaac
cagctgagcacgcccgggccctcgccgcacagcacctacaccaccctgctcctgcacgcc
ttccaggccacctttgggccccactgcgacctgccgggtttgcactgcaggctgcagtcc
aagaccctggccgagcttgaggacatcttcacggagacggcagaggcccaggaactggca
tccggcatcggggatgctgccgaggcccgccagtggctcaggaccaagctgcaggcagtg
ggagagaaagccggcttccctggtgtcctagacaccgccaaacccggcaagctgcgcacc
atccccatgcccgtggccaggtgctacacctacagctggaaccaggacagcttcgacatc
ctgcaggaaatcctgctgaaggaacaagagctgctccaaccgggcatcctaggggacgac
gaggatgaggacggggaggaggaggatgaggatgaggacgaggaggaggaggacttggac
agcgacaggcactctgccgagagggactctctgctctccaccagctccgcagcctcccgc
gactccaccctgtcccttgcctcgtcccaggcctcaggacccaccctccaccgccagctg
ctgacctccttcgtgtcgggcctgtcggacggcatggacagtggctacgtggaggacagt
gaggagagctccttcgagaggcccaaaaggcctggcagccaagaacgccggggccaccgc
aggtccggacagaagttcaacaggatctataaactcttcaagagcaccagccagctcgtg
cttcggagggactcccgggccctggagggctgcccggacagcgccctgcccctgcggcgg
gccggcagcctctgtagccccgtcagccccctggacggcccgaggcccgcctcccgggcc
cagcgctcacgctccctgccccaggcaaagctcagccccccgctgcccggctggctcctg
gcccccgcctcccgccaccagcgccgccgccccttcctgagcggggacgaggaccccaag
gcctccacgttgcgagtcgtggtcttcggctccgatcggatctcggggaaggtggcccgg
gcatacagcaaactgcggcggctggagagcaaccgtccgctcctcacacggttcttcaag
ctccaattcttctatgtgcccgtgaagcggagccaaggaactggtggctgcaccagccca
gcttctccatgccagacgtcctccctccccgcagactccccgaggcaccccagccctgcg
gagctgggcacagccccctggggcgagagcaccaacgacatctcccactacctcggcatg
ctcgacccctggtatgagcgcaacgtgctgggcctcatgcacctgccccctgaagtcctg
tgccagcagtctctgaaggcggagtcccggcccctggagggctcccctgcccagctgccc
atcctggccgacatgctgctctattactgccgctttgctgcccgcccggtgctgctacag
gtctatcagaccgagctgaccttcatcaccggggagaagacgacagagatcttcatccac
tccctggagctgggtcactctgctgccacgcgtgccatcaaggcttcaggtcctggcagc
aagcggctgggcattgacggtgaccgggaggctgtcccgctaacactacagattatctac
agcaagggggccatcagcggacgcagtcgctggagcaacatggagaaggtctgcacctct
gtcaacctcagcaaggcctgccggcagcaggaggagttagactcgagcacagaggccctg
atgctgaacctgacagaagtggtgaaaaggcagaaccctaaatctaagaagggcttcaac
cagattaccacgtcacaggtcaaagtggacaaggtgcagatcatcggctctaacacctgc
ccctttgctgtgtgcctggaccaggacgagcggaagatcctgcagagtgtggtcaggtgc
gaggtctcgccctgctacaagcccgagaagagcaacctctgcccccagccccagaggccc
tcccacccaccggcgcaggggcagaccacgcctgacctctgctccctgctctgtctgccc
atcatgaccttcagcggagctctgccctag

KEGG   Capra hircus (goat): 102173256
Entry
102173256         CDS       T02910                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04072  Phospholipase D signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04371  Apelin signaling pathway
chx04611  Platelet activation
chx04725  Cholinergic synapse
chx04921  Oxytocin signaling pathway
chx05132  Salmonella infection
chx05145  Toxoplasmosis
chx05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102173256 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102173256 (PIK3CG)
   04072 Phospholipase D signaling pathway
    102173256 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    102173256 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    102173256 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102173256 (PIK3CG)
   04062 Chemokine signaling pathway
    102173256 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102173256 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102173256 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    102173256 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102173256 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102173256 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102173256 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102173256 (PIK3CG)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102173256 (PIK3CG)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102173256 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 102173256
NCBI-ProteinID: XP_005679184
UniProt: A0A452E4F8
LinkDB
Position
4
AA seq 1102 aa
MELENHEQPVVLREDNCRRRRRMKPRSTAASLNSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRVLETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHLVQRHSPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPRLYAMHPWVTSKPLPEYLLKKITNNCVFIIIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVIFQLKQKLEILQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLSHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagaaccatgagcagcctgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccccgcagcacagcggctagcctgaactccatggagctcatccccatt
gagttcgtgctgcccaccagccaacgcaacaccaagacccccgaaacggcgctgctgcat
gtggccggccacggcaacgtggagcagatgaaggcccaagtgtggctgcgcgtgctggag
accagtgtggccgccgacttctaccaccggctgggccccgaccacttcctcctgctctac
cagaagaaagggcagtggtatgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcgctactggaaggtgctgcaccggagccccgggcagatccacctggttcagcgg
cactcgccctcagaggagacgctggcctttcagcgccagctcactgcgctcatcggctac
gatgtcacagatgtcagcaacgtgcacgacgacgagctggagttcacacgccgccgcctg
gtcaccccgcgtatggccgaggtggctggccgcgaccccaggctctacgccatgcacccc
tgggtgacgtctaagcctctcccggagtacctgctgaagaagatcaccaacaactgcgtc
ttcatcatcattcaccgcagtaccaccagccagaccatcaaggtctcggctgatgatacc
ccgggcaccatcctccagagcttctttaccaaaatggccaagaagaagtccctgatggat
atccccgagagccagaacgaacaggacttcgtgctgcgtgtctgcggccgcgatgagtac
ctggtgggcgagacgcccatcaaaaactttcagtgggtgcggcagtgccttaagaatggt
gaagagattcacctggtgcttgacactccgccggacccagccctggacgaggtgaggaag
gaagagtggccgctggtggatgactgcaccggagtcactggctaccacgagcagctaacc
atccacgggaaggaccatgagagcgtgttcactgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcaggggcatcgatatccccgtcctgccccggaatgcagatctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaaccagc
cccaaacccttcacggaggaggtgctctggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctcaatctccagatctactgtggcaaagcaccagct
ctgtctggtaaggcctctgcagagactcccagtcccgagtccagaggcaaagctcagctt
ctctactacgtgaacttgctgctcatcgaccaccgattcctcctgcgccacggcgagtat
gtgctccacatgtggcagttatctgggaagggggaagaccaagggagcttcaatgcagac
aagctcacatctgccaccaaccccgacaaggaaaactcaatgtccatctccattctcctg
gacaactactgtcaccccatagccttgcctaagcatcagcccacccctgacccggaaggg
gaccgcgtacgagcagaaatgcccaaccaacttcggaagcaactggaggcaatcatagct
actgatccacttaaccctctcactgcggaagacaaagaattgctttggcatttcagatat
gaaagccttaaggatcccaaagcataccctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaattgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacgatgcaactcctggactgcaacttttcggatgaaaacgta
agagccattgcagttcagaaactggagagcttggaagacgatgacgttctgcattacctg
ctccaactggtccaggctgtgaaattcgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtcgagacactatcagcagaggtttgcagtgattctggaggcctac
ctgaggggctgtggcaccgccatgctacgagacttcactcaacaagtccaagtaatcgac
atgttacaaaaagtcaccattgatattaaatcactctctgctgaaaagtatgacgtcagc
tcccaagttattttccaactaaagcaaaagcttgaaatcctgcagaatttgaatctcccc
caaagctttagagttccatatgaccctggactgaaggcaggcgcactggtgattgaaaaa
tgtaaagtgatggcctctaagaaaaaacccctgtggcttgagtttaaatgtgctgaccct
acagctctatcaaatgaaacaattggaattatctttaaacacggcgatgatctacgccaa
gacatgcttattttacagattctgcgaatcatggaatccatttgggagactgaatctttg
gacctgtgcctcctgccgtatggttgcatttcaactggtgacaaaataggaatgattgag
attgtaaaagatgccacaacgatcgccaaaattcaacaaagcacagtgggcaacacggga
gcctttaaagatgaagtgctgagtcactggctcaaagaaaaatgccctattgaagaaaag
tttcaggcagcagtggagagattcgtttattcctgtgctggctactgtgtggcaaccttt
gttcttgggataggcgacagacacaatgacaatattatgatctcagagacaggaaatcta
tttcatattgactttgggcacattcttgggaattataaaagtttcctgggcattaataaa
gagagagtgccattcgtgctaactccagacttcctgtttgtgatggggacttcgggaaag
aagacaagtctacacttccagaaatttcaggatgtgtgcgtcaaggcttacctagccctt
cgtcatcacacaaatctactgatcattctgttctccatgatgctgatgacaggaatgccc
cagttaaccagcaaagaagatatcgaatacattcgggatgccctaacagtagggaagagc
gaggaggatgctaaaaagtattttctggatcagattgaagtttgcagggacaaaggatgg
actgtgcagtttaactggttcctacatctcgttcttggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system