Capra hircus (goat): 102172519 Help Entry 102172519         CDS       T02910                                  Gene name KRAS Definition (RefSeq) KRAS proto-oncogene, GTPase   KO K07827   GTPase KRas Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04012   ErbB signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04062   Chemokine signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04211   Longevity regulating pathway chx04213   Longevity regulating pathway - multiple species chx04218   Cellular senescence chx04360   Axon guidance chx04370   VEGF signaling pathway chx04371   Apelin signaling pathway chx04540   Gap junction chx04550   Signaling pathways regulating pluripotency of stem cells chx04625   C-type lectin receptor signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04714   Thermogenesis chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04725   Cholinergic synapse chx04726   Serotonergic synapse chx04730   Long-term depression chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04912   GnRH signaling pathway chx04914   Progesterone-mediated oocyte maturation chx04915   Estrogen signaling pathway chx04916   Melanogenesis chx04917   Prolactin signaling pathway chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04926   Relaxin signaling pathway chx04929   GnRH secretion chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx04960   Aldosterone-regulated sodium reabsorption chx05010   Alzheimer disease chx05022   Pathways of neurodegeneration - multiple diseases chx05034   Alcoholism chx05160   Hepatitis C chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05211   Renal cell carcinoma chx05212   Pancreatic cancer chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05221   Acute myeloid leukemia chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05231   Choline metabolism in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102172519 (KRAS)    04012 ErbB signaling pathway     102172519 (KRAS)    04014 Ras signaling pathway     102172519 (KRAS)    04015 Rap1 signaling pathway     102172519 (KRAS)    04370 VEGF signaling pathway     102172519 (KRAS)    04371 Apelin signaling pathway     102172519 (KRAS)    04068 FoxO signaling pathway     102172519 (KRAS)    04072 Phospholipase D signaling pathway     102172519 (KRAS)    04071 Sphingolipid signaling pathway     102172519 (KRAS)    04151 PI3K-Akt signaling pathway     102172519 (KRAS)    04150 mTOR signaling pathway     102172519 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102172519 (KRAS)    04137 Mitophagy - animal     102172519 (KRAS)   09143 Cell growth and death    04210 Apoptosis     102172519 (KRAS)    04218 Cellular senescence     102172519 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102172519 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102172519 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102172519 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102172519 (KRAS)    04650 Natural killer cell mediated cytotoxicity     102172519 (KRAS)    04660 T cell receptor signaling pathway     102172519 (KRAS)    04662 B cell receptor signaling pathway     102172519 (KRAS)    04664 Fc epsilon RI signaling pathway     102172519 (KRAS)    04062 Chemokine signaling pathway     102172519 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102172519 (KRAS)    04929 GnRH secretion     102172519 (KRAS)    04912 GnRH signaling pathway     102172519 (KRAS)    04915 Estrogen signaling pathway     102172519 (KRAS)    04914 Progesterone-mediated oocyte maturation     102172519 (KRAS)    04917 Prolactin signaling pathway     102172519 (KRAS)    04921 Oxytocin signaling pathway     102172519 (KRAS)    04926 Relaxin signaling pathway     102172519 (KRAS)    04935 Growth hormone synthesis, secretion and action     102172519 (KRAS)    04919 Thyroid hormone signaling pathway     102172519 (KRAS)    04916 Melanogenesis     102172519 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102172519 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     102172519 (KRAS)    04726 Serotonergic synapse     102172519 (KRAS)    04720 Long-term potentiation     102172519 (KRAS)    04730 Long-term depression     102172519 (KRAS)    04722 Neurotrophin signaling pathway     102172519 (KRAS)   09158 Development and regeneration    04360 Axon guidance     102172519 (KRAS)   09149 Aging    04211 Longevity regulating pathway     102172519 (KRAS)    04213 Longevity regulating pathway - multiple species     102172519 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     102172519 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102172519 (KRAS)    05206 MicroRNAs in cancer     102172519 (KRAS)    05205 Proteoglycans in cancer     102172519 (KRAS)    05203 Viral carcinogenesis     102172519 (KRAS)    05230 Central carbon metabolism in cancer     102172519 (KRAS)    05231 Choline metabolism in cancer     102172519 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102172519 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102172519 (KRAS)    05212 Pancreatic cancer     102172519 (KRAS)    05225 Hepatocellular carcinoma     102172519 (KRAS)    05226 Gastric cancer     102172519 (KRAS)    05214 Glioma     102172519 (KRAS)    05216 Thyroid cancer     102172519 (KRAS)    05221 Acute myeloid leukemia     102172519 (KRAS)    05220 Chronic myeloid leukemia     102172519 (KRAS)    05218 Melanoma     102172519 (KRAS)    05211 Renal cell carcinoma     102172519 (KRAS)    05219 Bladder cancer     102172519 (KRAS)    05215 Prostate cancer     102172519 (KRAS)    05213 Endometrial cancer     102172519 (KRAS)    05224 Breast cancer     102172519 (KRAS)    05223 Non-small cell lung cancer     102172519 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102172519 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     102172519 (KRAS)   09165 Substance dependence    05034 Alcoholism     102172519 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102172519 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102172519 (KRAS)    05170 Human immunodeficiency virus 1 infection     102172519 (KRAS)    05161 Hepatitis B     102172519 (KRAS)    05160 Hepatitis C     102172519 (KRAS)    05163 Human cytomegalovirus infection     102172519 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102172519 (KRAS)    05165 Human papillomavirus infection     102172519 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102172519 (KRAS)    01522 Endocrine resistance     102172519 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102172519 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:chx04031]     102172519 (KRAS) Membrane trafficking [BR:chx04131]  Endocytosis   Macropinocytosis    Ras GTPases     102172519 (KRAS) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102172519 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA Motif Other DBs NCBI-GeneID:  102172519 NCBI-ProteinID:  XP_017903877 UniProt:  A0A452G867 LinkDB All DBs Position 5 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattgttatgtaa

Capra hircus (goat): 102184366 Help Entry 102184366         CDS       T02910                                  Gene name RRAS Definition (RefSeq) related RAS viral (r-ras) oncogene homolog   KO K07829   Ras-related protein R-Ras Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04024   cAMP signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04218   Cellular senescence chx04360   Axon guidance chx04371   Apelin signaling pathway chx04625   C-type lectin receptor signaling pathway chx04810   Regulation of actin cytoskeleton chx05132   Salmonella infection chx05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102184366 (RRAS)    04014 Ras signaling pathway     102184366 (RRAS)    04015 Rap1 signaling pathway     102184366 (RRAS)    04371 Apelin signaling pathway     102184366 (RRAS)    04072 Phospholipase D signaling pathway     102184366 (RRAS)    04024 cAMP signaling pathway     102184366 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102184366 (RRAS)    04137 Mitophagy - animal     102184366 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102184366 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102184366 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102184366 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102184366 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102184366 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102184366 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:chx04031]     102184366 (RRAS) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102184366 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22 SRPRB Motif Other DBs NCBI-GeneID:  102184366 NCBI-ProteinID:  XP_005692901 UniProt:  A0A452G0K4 LinkDB All DBs Position 18 AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICAVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKARGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactacgacccc actattgaagactcctacacgaagatctgcgctgtggatggcgtcccagcccggctagac atcctggacaccgccggccaggaggagtttggtgccatgcgggaacagtacatgcgtgcg ggccacggcttcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagctcttcacgcagatccttcgagtcaaggaccgagacgacttccccatcgtgttggtt ggcaacaaggcggatctggaaacacagcgccaggtcccccgatctgaagcctccaccttc agtgcctcccaccacgtggcctactttgaagcttctgccaaactgcgcctcaacgtggat gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tccccgcccagcgcccccaggaagaaggccagaggctgcccctgtgtccttctgtag

Capra hircus (goat): 102185873 Help Entry 102185873         CDS       T02910                                  Gene name MRAS Definition (RefSeq) muscle RAS oncogene homolog   KO K07831   Ras-related protein M-Ras Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04218   Cellular senescence chx04371   Apelin signaling pathway chx04625   C-type lectin receptor signaling pathway chx04810   Regulation of actin cytoskeleton chx05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102185873 (MRAS)    04014 Ras signaling pathway     102185873 (MRAS)    04015 Rap1 signaling pathway     102185873 (MRAS)    04371 Apelin signaling pathway     102185873 (MRAS)    04072 Phospholipase D signaling pathway     102185873 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102185873 (MRAS)    04137 Mitophagy - animal     102185873 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     102185873 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102185873 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102185873 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102185873 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:chx04031]     102185873 (MRAS) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102185873 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  102185873 NCBI-ProteinID:  XP_005675569 UniProt:  A0A452G4K8 LinkDB All DBs Position 1 AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaacgagtgcagtccccagcgacaacctccccacgtacaagctggtggtggtggga gatgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactacgaccccaccatcgaagactcctacctgaaacatacagagattgacaatcagtgg gccatcttggatgttctggacacggccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacgggggacggcttcctcatcgtcttctcggtcacggacaaggccagcttc gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg atgatcctcgtggccaacaaggtcgatctgatgcatttgaggaaaatcaccagggagcaa ggaaaagaaatggcgaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacaaagccttccacgacctggttagagtaattaggcagcagattccg gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccacgggcacc cacaaactgcagtgtgtgatattgtga

Capra hircus (goat): 102186668 Help Entry 102186668         CDS       T02910                                  Gene name HRAS Definition (RefSeq) HRas proto-oncogene, GTPase   KO K02833   GTPase HRas Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04012   ErbB signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04062   Chemokine signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04144   Endocytosis chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04211   Longevity regulating pathway chx04213   Longevity regulating pathway - multiple species chx04218   Cellular senescence chx04360   Axon guidance chx04370   VEGF signaling pathway chx04371   Apelin signaling pathway chx04510   Focal adhesion chx04540   Gap junction chx04550   Signaling pathways regulating pluripotency of stem cells chx04625   C-type lectin receptor signaling pathway chx04630   JAK-STAT signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04714   Thermogenesis chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04725   Cholinergic synapse chx04726   Serotonergic synapse chx04730   Long-term depression chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04912   GnRH signaling pathway chx04915   Estrogen signaling pathway chx04916   Melanogenesis chx04917   Prolactin signaling pathway chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04926   Relaxin signaling pathway chx04929   GnRH secretion chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx05010   Alzheimer disease chx05022   Pathways of neurodegeneration - multiple diseases chx05034   Alcoholism chx05132   Salmonella infection chx05160   Hepatitis C chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05211   Renal cell carcinoma chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05221   Acute myeloid leukemia chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05231   Choline metabolism in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102186668 (HRAS)    04012 ErbB signaling pathway     102186668 (HRAS)    04014 Ras signaling pathway     102186668 (HRAS)    04015 Rap1 signaling pathway     102186668 (HRAS)    04370 VEGF signaling pathway     102186668 (HRAS)    04371 Apelin signaling pathway     102186668 (HRAS)    04630 JAK-STAT signaling pathway     102186668 (HRAS)    04068 FoxO signaling pathway     102186668 (HRAS)    04072 Phospholipase D signaling pathway     102186668 (HRAS)    04071 Sphingolipid signaling pathway     102186668 (HRAS)    04151 PI3K-Akt signaling pathway     102186668 (HRAS)    04150 mTOR signaling pathway     102186668 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102186668 (HRAS)    04140 Autophagy - animal     102186668 (HRAS)    04137 Mitophagy - animal     102186668 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102186668 (HRAS)    04218 Cellular senescence     102186668 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102186668 (HRAS)    04540 Gap junction     102186668 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102186668 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102186668 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102186668 (HRAS)    04650 Natural killer cell mediated cytotoxicity     102186668 (HRAS)    04660 T cell receptor signaling pathway     102186668 (HRAS)    04662 B cell receptor signaling pathway     102186668 (HRAS)    04664 Fc epsilon RI signaling pathway     102186668 (HRAS)    04062 Chemokine signaling pathway     102186668 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102186668 (HRAS)    04929 GnRH secretion     102186668 (HRAS)    04912 GnRH signaling pathway     102186668 (HRAS)    04915 Estrogen signaling pathway     102186668 (HRAS)    04917 Prolactin signaling pathway     102186668 (HRAS)    04921 Oxytocin signaling pathway     102186668 (HRAS)    04926 Relaxin signaling pathway     102186668 (HRAS)    04935 Growth hormone synthesis, secretion and action     102186668 (HRAS)    04919 Thyroid hormone signaling pathway     102186668 (HRAS)    04916 Melanogenesis     102186668 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     102186668 (HRAS)    04726 Serotonergic synapse     102186668 (HRAS)    04720 Long-term potentiation     102186668 (HRAS)    04730 Long-term depression     102186668 (HRAS)    04722 Neurotrophin signaling pathway     102186668 (HRAS)   09158 Development and regeneration    04360 Axon guidance     102186668 (HRAS)   09149 Aging    04211 Longevity regulating pathway     102186668 (HRAS)    04213 Longevity regulating pathway - multiple species     102186668 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     102186668 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102186668 (HRAS)    05206 MicroRNAs in cancer     102186668 (HRAS)    05205 Proteoglycans in cancer     102186668 (HRAS)    05203 Viral carcinogenesis     102186668 (HRAS)    05230 Central carbon metabolism in cancer     102186668 (HRAS)    05231 Choline metabolism in cancer     102186668 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102186668 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102186668 (HRAS)    05225 Hepatocellular carcinoma     102186668 (HRAS)    05226 Gastric cancer     102186668 (HRAS)    05214 Glioma     102186668 (HRAS)    05216 Thyroid cancer     102186668 (HRAS)    05221 Acute myeloid leukemia     102186668 (HRAS)    05220 Chronic myeloid leukemia     102186668 (HRAS)    05218 Melanoma     102186668 (HRAS)    05211 Renal cell carcinoma     102186668 (HRAS)    05219 Bladder cancer     102186668 (HRAS)    05215 Prostate cancer     102186668 (HRAS)    05213 Endometrial cancer     102186668 (HRAS)    05224 Breast cancer     102186668 (HRAS)    05223 Non-small cell lung cancer     102186668 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102186668 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     102186668 (HRAS)   09165 Substance dependence    05034 Alcoholism     102186668 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102186668 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102186668 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102186668 (HRAS)    05170 Human immunodeficiency virus 1 infection     102186668 (HRAS)    05161 Hepatitis B     102186668 (HRAS)    05160 Hepatitis C     102186668 (HRAS)    05163 Human cytomegalovirus infection     102186668 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102186668 (HRAS)    05165 Human papillomavirus infection     102186668 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102186668 (HRAS)    01522 Endocrine resistance     102186668 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102186668 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102186668 (HRAS)    04031 GTP-binding proteins [BR:chx04031]     102186668 (HRAS) Membrane trafficking [BR:chx04131]  Endocytosis   Macropinocytosis    Ras GTPases     102186668 (HRAS) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102186668 (HRAS)   Exosomal proteins of colorectal cancer cells    102186668 (HRAS) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102186668 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin Ldh_1_N AAA_25 Motif Other DBs NCBI-GeneID:  102186668 NCBI-ProteinID:  XP_017899042 UniProt:  A0A452DR48 LinkDB All DBs Position 29 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINHTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKMRKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgccggcggcgtggggaagagcgccctgacc atccagctcattcagaaccacttcgtggacgagtatgaccccaccatcgaggactcctac cggaagcaagtggtcatcgacggggagacgtgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctctgc gtgtttgccatcaaccacaccaagtccttcgaggacatccatcagtaccgggagcagatc aagagggtgaaggactcggacgacgtgcccatggtgttggtcgggaacaagtgcgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcattccg tacatcgagacctccgccaagacccgccagggcgtggaggacgccttctacaccctggtg cgcgagatccggcagcacaagatgcgcaagctgagcccaccggacgagggcggccccggc tgcctgagctgcaggtgcctgctctcctga

Capra hircus (goat): 102187180 Help Entry 102187180         CDS       T02910                                  Gene name NRAS Definition (RefSeq) neuroblastoma RAS viral oncogene homolog   KO K07828   GTPase NRas Organism chx  Capra hircus (goat) Pathway chx01521   EGFR tyrosine kinase inhibitor resistance chx01522   Endocrine resistance chx04010   MAPK signaling pathway chx04012   ErbB signaling pathway chx04014   Ras signaling pathway chx04015   Rap1 signaling pathway chx04062   Chemokine signaling pathway chx04068   FoxO signaling pathway chx04071   Sphingolipid signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04150   mTOR signaling pathway chx04151   PI3K-Akt signaling pathway chx04210   Apoptosis chx04211   Longevity regulating pathway chx04213   Longevity regulating pathway - multiple species chx04218   Cellular senescence chx04360   Axon guidance chx04370   VEGF signaling pathway chx04371   Apelin signaling pathway chx04540   Gap junction chx04550   Signaling pathways regulating pluripotency of stem cells chx04625   C-type lectin receptor signaling pathway chx04650   Natural killer cell mediated cytotoxicity chx04660   T cell receptor signaling pathway chx04662   B cell receptor signaling pathway chx04664   Fc epsilon RI signaling pathway chx04714   Thermogenesis chx04720   Long-term potentiation chx04722   Neurotrophin signaling pathway chx04725   Cholinergic synapse chx04726   Serotonergic synapse chx04730   Long-term depression chx04810   Regulation of actin cytoskeleton chx04910   Insulin signaling pathway chx04912   GnRH signaling pathway chx04915   Estrogen signaling pathway chx04916   Melanogenesis chx04917   Prolactin signaling pathway chx04919   Thyroid hormone signaling pathway chx04921   Oxytocin signaling pathway chx04926   Relaxin signaling pathway chx04929   GnRH secretion chx04933   AGE-RAGE signaling pathway in diabetic complications chx04935   Growth hormone synthesis, secretion and action chx05010   Alzheimer disease chx05022   Pathways of neurodegeneration - multiple diseases chx05034   Alcoholism chx05160   Hepatitis C chx05161   Hepatitis B chx05163   Human cytomegalovirus infection chx05165   Human papillomavirus infection chx05166   Human T-cell leukemia virus 1 infection chx05167   Kaposi sarcoma-associated herpesvirus infection chx05170   Human immunodeficiency virus 1 infection chx05200   Pathways in cancer chx05203   Viral carcinogenesis chx05205   Proteoglycans in cancer chx05206   MicroRNAs in cancer chx05210   Colorectal cancer chx05211   Renal cell carcinoma chx05213   Endometrial cancer chx05214   Glioma chx05215   Prostate cancer chx05216   Thyroid cancer chx05218   Melanoma chx05219   Bladder cancer chx05220   Chronic myeloid leukemia chx05221   Acute myeloid leukemia chx05223   Non-small cell lung cancer chx05224   Breast cancer chx05225   Hepatocellular carcinoma chx05226   Gastric cancer chx05230   Central carbon metabolism in cancer chx05231   Choline metabolism in cancer chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102187180 (NRAS)    04012 ErbB signaling pathway     102187180 (NRAS)    04014 Ras signaling pathway     102187180 (NRAS)    04015 Rap1 signaling pathway     102187180 (NRAS)    04370 VEGF signaling pathway     102187180 (NRAS)    04371 Apelin signaling pathway     102187180 (NRAS)    04068 FoxO signaling pathway     102187180 (NRAS)    04072 Phospholipase D signaling pathway     102187180 (NRAS)    04071 Sphingolipid signaling pathway     102187180 (NRAS)    04151 PI3K-Akt signaling pathway     102187180 (NRAS)    04150 mTOR signaling pathway     102187180 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102187180 (NRAS)    04137 Mitophagy - animal     102187180 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102187180 (NRAS)    04218 Cellular senescence     102187180 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102187180 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102187180 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102187180 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102187180 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102187180 (NRAS)    04660 T cell receptor signaling pathway     102187180 (NRAS)    04662 B cell receptor signaling pathway     102187180 (NRAS)    04664 Fc epsilon RI signaling pathway     102187180 (NRAS)    04062 Chemokine signaling pathway     102187180 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102187180 (NRAS)    04929 GnRH secretion     102187180 (NRAS)    04912 GnRH signaling pathway     102187180 (NRAS)    04915 Estrogen signaling pathway     102187180 (NRAS)    04917 Prolactin signaling pathway     102187180 (NRAS)    04921 Oxytocin signaling pathway     102187180 (NRAS)    04926 Relaxin signaling pathway     102187180 (NRAS)    04935 Growth hormone synthesis, secretion and action     102187180 (NRAS)    04919 Thyroid hormone signaling pathway     102187180 (NRAS)    04916 Melanogenesis     102187180 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102187180 (NRAS)    04726 Serotonergic synapse     102187180 (NRAS)    04720 Long-term potentiation     102187180 (NRAS)    04730 Long-term depression     102187180 (NRAS)    04722 Neurotrophin signaling pathway     102187180 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102187180 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102187180 (NRAS)    04213 Longevity regulating pathway - multiple species     102187180 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102187180 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102187180 (NRAS)    05206 MicroRNAs in cancer     102187180 (NRAS)    05205 Proteoglycans in cancer     102187180 (NRAS)    05203 Viral carcinogenesis     102187180 (NRAS)    05230 Central carbon metabolism in cancer     102187180 (NRAS)    05231 Choline metabolism in cancer     102187180 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102187180 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102187180 (NRAS)    05225 Hepatocellular carcinoma     102187180 (NRAS)    05226 Gastric cancer     102187180 (NRAS)    05214 Glioma     102187180 (NRAS)    05216 Thyroid cancer     102187180 (NRAS)    05221 Acute myeloid leukemia     102187180 (NRAS)    05220 Chronic myeloid leukemia     102187180 (NRAS)    05218 Melanoma     102187180 (NRAS)    05211 Renal cell carcinoma     102187180 (NRAS)    05219 Bladder cancer     102187180 (NRAS)    05215 Prostate cancer     102187180 (NRAS)    05213 Endometrial cancer     102187180 (NRAS)    05224 Breast cancer     102187180 (NRAS)    05223 Non-small cell lung cancer     102187180 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102187180 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102187180 (NRAS)   09165 Substance dependence    05034 Alcoholism     102187180 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102187180 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102187180 (NRAS)    05170 Human immunodeficiency virus 1 infection     102187180 (NRAS)    05161 Hepatitis B     102187180 (NRAS)    05160 Hepatitis C     102187180 (NRAS)    05163 Human cytomegalovirus infection     102187180 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102187180 (NRAS)    05165 Human papillomavirus infection     102187180 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102187180 (NRAS)    01522 Endocrine resistance     102187180 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:chx04131]     102187180 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102187180 (NRAS)    04031 GTP-binding proteins [BR:chx04031]     102187180 (NRAS) Membrane trafficking [BR:chx04131]  Endocytosis   Macropinocytosis    Ras GTPases     102187180 (NRAS) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102187180 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102187180 (NRAS)   Exosomal proteins of breast cancer cells    102187180 (NRAS)   Exosomal proteins of colorectal cancer cells    102187180 (NRAS) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102187180 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  102187180 NCBI-ProteinID:  XP_005677891 UniProt:  A0A452FSF6 LinkDB All DBs Position 3 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagagaacagatt aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgacttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagctatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggcactcaaggt tgtatggggttgccatgtgtggtaatgtaa

Capra hircus (goat): 102190712 Help Entry 102190712         CDS       T02910                                  Gene name RRAS2 Definition (RefSeq) related RAS viral (r-ras) oncogene homolog 2   KO K07830   Ras-related protein R-Ras2 Organism chx  Capra hircus (goat) Pathway chx04010   MAPK signaling pathway chx04014   Ras signaling pathway chx04024   cAMP signaling pathway chx04072   Phospholipase D signaling pathway chx04137   Mitophagy - animal chx04140   Autophagy - animal chx04218   Cellular senescence chx04371   Apelin signaling pathway chx04625   C-type lectin receptor signaling pathway chx04810   Regulation of actin cytoskeleton chx05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:chx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102190712 (RRAS2)    04014 Ras signaling pathway     102190712 (RRAS2)    04371 Apelin signaling pathway     102190712 (RRAS2)    04072 Phospholipase D signaling pathway     102190712 (RRAS2)    04024 cAMP signaling pathway     102190712 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102190712 (RRAS2)    04137 Mitophagy - animal     102190712 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     102190712 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102190712 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102190712 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102190712 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:chx04147]     102190712 (RRAS2)    04031 GTP-binding proteins [BR:chx04031]     102190712 (RRAS2) Exosome [BR:chx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102190712 (RRAS2)   Exosomal proteins of bladder cancer cells    102190712 (RRAS2) GTP-binding proteins [BR:chx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102190712 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075 Motif Other DBs NCBI-GeneID:  102190712 NCBI-ProteinID:  XP_017915074 UniProt:  A0A452FJ48 LinkDB All DBs Position 15 AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctggtggtggtc ggcggaggcggtgtgggcaaatcggcgctcaccatccagttcatccagtcttattttgta acggattatgatccaaccatcgaggattcctacacaaagcagtgcgtgatagatgaccgg gcggcccgtctagacattctggatacagcgggacaagaggaatttggagctatgagagaa cagtatatgagaactggcgagggtttccttttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttt ccaatgattttaattggtaataaagcagatctggatcatcagagacaggtaacacaggaa gaaggacagcagttagcacggcaacttaaggtaacatacatggaggcgtcagcaaagatt aggatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctaa

DBGET integrated database retrieval system