KEGG   Capra hircus (goat): 102172659
Entry
102172659         CDS       T02910                                 

Gene name
TBKBP1
Definition
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102172659 (TBKBP1)
SSDB
Motif
Pfam: TBD Zn-C2H2_12 CT_C_D Seryl_tRNA_N
Other DBs
NCBI-GeneID: 102172659
NCBI-ProteinID: XP_017920448
LinkDB
Position
19
AA seq 614 aa
MESMFEDDISILTQEALGPSEVWLDAPGDPSLGEDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEQQLRQQQGLRDVDF
PSLSPPPAPAPPCADLDLHYLALRGGSSLNHGWPGATPSMSELERRRLEEALEAAQGEAR
GAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTEL
TEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSHSPPARAAPPCP
PCQSPVPQRRSPGPPCPSPQQRRSPASPSCPSPVPQRRSPVPPPCQSPSPQRRSPGPPTC
PAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSEMAEGAGYAGASPPWLQA
EAATLPKPRAYGGELYGPGRPLSPRRAFEGIRLRFEKQPSEEEEWAVPASPPSPETGAIR
CASFCAGFPVPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDA
LIKHIDSHLENSKI
NT seq 1845 nt   +upstreamnt  +downstreamnt
atggagtccatgtttgaggatgacatcagcatcctgacccaggaggccctggggcccagt
gaggtgtggctggatgcccctggagacccctcgctgggggaggacatgtgctctgcctcc
cactttgccctgatcacagcctacggagacatcaaggagaggctggggggcctggagagg
gagaatgccaccctccgccgccgcctcaaagtctacgagatcaagtacccactgatcagt
gactttggggaggagcacggtttctctctgtatgaaatcaaggatggttccctgctggag
gtggagaaagtcagcctgcagcaacggctcaaccagttccagcatgagttgcagaaaaac
aaggagcaggaagaacagcttggggagatgatccaggcttacgagaagctctgcgtagag
aagagtgacctggagacggagctgggggagatgcgggccctggtggagactcacctgcgg
cagatctgtggtttggagcagcagctgcggcagcagcaaggcctccgggatgtagacttc
cccagcctgagccccccgcccgcccctgccccgccctgtgctgatctggaccttcactac
ttggcactgagagggggatccagcttgaatcatggctggccaggcgccacgccgagtatg
agtgagctggagcggcggcggctggaagaggctctggaggctgcccagggagaggcccga
ggggctcagcttcgggaggagcagctccaggccgagtgtgagcggctgcagggggagctg
aagcagctgcaggagacccgggcccaggatctagcctccaaccagtcggagcgggacatg
gcgtgggtgaaaagagttggggatgatcaggtaaatttggcactggcttacacggagctg
accgaggagctgggccggcttagggagctgagttcgctgcaggggaggatcctgaggacg
ctgttgcaggagcaggcccggagtggcggccagaggcactcgccgctgtcgcagcgccac
tccccggccccccagtgcccctcgcactccccgccggcccgcgcggcgcccccgtgtccc
ccttgccagtcccctgtcccccagcgccgctcccctgggcccccctgcccctcgccccag
cagcgccgctctccggcctcgccctcctgtccgtcgcccgtcccgcagcgccgctcgccg
gtgccgccgccgtgtcagtcccccagcccgcagcgccgctccccagggccccccacctgc
ccggccccgcagccccggcctccgccgcccccgccgcccggggagaggacgctggccgag
cgagcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccggcgcagc
tactccgagatggcggagggcgcgggctacgcgggcgcctccccgccctggctgcaagcc
gaggcggccacgctgcccaagccgcgggcctacggcggcgagctctacggtcccggccgg
cccctcagtccgcggcgcgccttcgagggcatccgcctgcgcttcgagaagcagccgtcg
gaggaggaggagtgggccgtgcccgccagtccgcccagcccggagaccggcgccatccgc
tgcgcctcgttctgcgcgggcttcccggtccccgagtcgcccgccgccaccgcctacgcc
cacgccgagcacgcgcagtcctggccgtccattaacctgctgatggagacagtgggctct
gatatccgcagctgccccctctgccagctgggtttcccagtcgggtacccagatgatgcc
ctcatcaaacacattgactcccatctggagaacagcaagatctag

DBGET integrated database retrieval system