KEGG   Capra hircus (goat): 102172719
Entry
102172719         CDS       T02910                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04140  Autophagy - animal
chx04152  AMPK signaling pathway
chx04310  Wnt signaling pathway
chx04380  Osteoclast differentiation
chx04520  Adherens junction
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04660  T cell receptor signaling pathway
chx04668  TNF signaling pathway
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05161  Hepatitis B
chx05162  Measles
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172719 (MAP3K7)
   04310 Wnt signaling pathway
    102172719 (MAP3K7)
   04064 NF-kappa B signaling pathway
    102172719 (MAP3K7)
   04668 TNF signaling pathway
    102172719 (MAP3K7)
   04152 AMPK signaling pathway
    102172719 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102172719 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102172719 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102172719 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    102172719 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    102172719 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    102172719 (MAP3K7)
   04660 T cell receptor signaling pathway
    102172719 (MAP3K7)
   04657 IL-17 signaling pathway
    102172719 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102172719 (MAP3K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102172719 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102172719 (MAP3K7)
   05135 Yersinia infection
    102172719 (MAP3K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102172719 (MAP3K7)
   05161 Hepatitis B
    102172719 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    102172719 (MAP3K7)
   05162 Measles
    102172719 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    102172719 (MAP3K7)
   05169 Epstein-Barr virus infection
    102172719 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102172719 (MAP3K7)
   05140 Leishmaniasis
    102172719 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102172719 (MAP3K7)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102172719 (MAP3K7)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: TKL group
  MLK family
   102172719 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 102172719
NCBI-ProteinID: XP_005684732
UniProt: A0A452EA85
LinkDB
Position
9
AA seq 579 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TDPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtctacagcctccgccgcttcttcctcctcctcgtcttccgccggtgagatgatcgaa
gccccctcccaagtcctcaactttgaagagatagactacaaggagatcgaggtggaagag
gttgttggaagaggagcttttggagtagtatgcaaagccaagtggagagcaaaagatgtt
gccattaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcgacag
ttatcgcgtgtgaaccatcctaacatcgtaaagctatatggagcctgcttgaatccagtg
tgtcttgtaatggaatatgctgaagggggctccttgtataatgtgctgcatggtgccgag
ccattgccatattacaccgctgcccacgcaatgagctggtgtttacagtgttcccaagga
gtggcgtatcttcacagcatgcagcccaaagctctaattcacagggacctgaaaccacca
aacttgctgctggttgcaggggggacagttttaaaaatctgtgattttggtacagcctgt
gacattcagacgcacatgaccaacaataaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgatgtcttcagttggggtattatcctttgg
gaagtgataacacgtcggaaaccctttgatgaaattggtggcccggctttccgtatcatg
tgggctgttcataacggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccgttacaatac
ccttgtcagtattcagatgaaggacagagcaactccgctaccagtacaggctccttcatg
gacatcgcttctacaaacaccagtaataaaagtgacacgaacatggaacaagttcctgcc
acaaacgatacaattaaacgcttagaatcaaaattgttgaaaaaccaggcaaaacaacag
agtgaatctgggcgtttgagcttgggagcttctcgtgggagcagcgtggagagcttgccc
ccaacctctgaaggcaagaggatgagtgccgatatgtctgaaatagaagccaggattgct
gcaaccacaggcaacgggcagccaagacgtagatccatccaagacttgactgttactgga
acagatcctggtcaggtgagcagtaggtcatccagtcctagcgtcagaatgatcactacc
tcaggaccaacctcagaaaagccagctcgcagtcatccatggacccctgatgattccaca
gataccaatggatcagataattccatcccaatggcttatcttacactggatcaccaacta
cagcctctagcaccatgcccaaactccaaagaatctatggcagtgtttgaacagcattgt
aagatggcacaggaatacatgaaagtccaaacagaaattgcattgttattacagagaaag
caggaactagttgcagaactggaccaggatgaaaaggaccagcaaaatacatctcgtctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttcaacttactatcagcaa
tgcaaaaaacagctagaggtcatcaggagtcagcagcaaaaacgacaaggcacttcatga

DBGET integrated database retrieval system