KEGG   Capra hircus (goat): 102172767
Entry
102172767         CDS       T02910                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04144  Endocytosis
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04540  Gap junction
chx04630  JAK-STAT signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx05160  Hepatitis C
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172767 (EGFR)
   04012 ErbB signaling pathway
    102172767 (EGFR)
   04014 Ras signaling pathway
    102172767 (EGFR)
   04015 Rap1 signaling pathway
    102172767 (EGFR)
   04630 JAK-STAT signaling pathway
    102172767 (EGFR)
   04066 HIF-1 signaling pathway
    102172767 (EGFR)
   04068 FoxO signaling pathway
    102172767 (EGFR)
   04020 Calcium signaling pathway
    102172767 (EGFR)
   04072 Phospholipase D signaling pathway
    102172767 (EGFR)
   04151 PI3K-Akt signaling pathway
    102172767 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102172767 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102172767 (EGFR)
   04520 Adherens junction
    102172767 (EGFR)
   04540 Gap junction
    102172767 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102172767 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102172767 (EGFR)
   04915 Estrogen signaling pathway
    102172767 (EGFR)
   04921 Oxytocin signaling pathway
    102172767 (EGFR)
   04926 Relaxin signaling pathway
    102172767 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    102172767 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102172767 (EGFR)
   05206 MicroRNAs in cancer
    102172767 (EGFR)
   05205 Proteoglycans in cancer
    102172767 (EGFR)
   05230 Central carbon metabolism in cancer
    102172767 (EGFR)
   05231 Choline metabolism in cancer
    102172767 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102172767 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102172767 (EGFR)
   05212 Pancreatic cancer
    102172767 (EGFR)
   05225 Hepatocellular carcinoma
    102172767 (EGFR)
   05226 Gastric cancer
    102172767 (EGFR)
   05214 Glioma
    102172767 (EGFR)
   05218 Melanoma
    102172767 (EGFR)
   05219 Bladder cancer
    102172767 (EGFR)
   05215 Prostate cancer
    102172767 (EGFR)
   05213 Endometrial cancer
    102172767 (EGFR)
   05224 Breast cancer
    102172767 (EGFR)
   05223 Non-small cell lung cancer
    102172767 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102172767 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102172767 (EGFR)
   05171 Coronavirus disease - COVID-19
    102172767 (EGFR)
   05163 Human cytomegalovirus infection
    102172767 (EGFR)
   05165 Human papillomavirus infection
    102172767 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102172767 (EGFR)
   01522 Endocrine resistance
    102172767 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102172767 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102172767 (EGFR)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102172767 (EGFR)
Protein kinases [BR:chx01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102172767 (EGFR)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102172767 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   102172767 (EGFR)
  Exosomal proteins of bladder cancer cells
   102172767 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Borrelia_P83 APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 102172767
NCBI-ProteinID: XP_017922533
UniProt: A0A452FEC6
LinkDB
Position
22
AA seq 1208 aa
MRLSRAGRAALLVLLAAHFQASLALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSGYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPLRNLQEILQGAVRFSNNPVLCNMETIQWRDIINTDFLSNVTGDF
QNQQGNCSKCDPACLNRSCWGAGEENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCAKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTAPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYANTIHWKKL
FGTSTQKTKILNNRSDKECKATGHICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCN
ILEGEPREFVENSECVQCHPECLPQAMNVTCTGRGPGSCVKCAHYIDGPHCVKACPAGVA
GENGTLVWKFADASHVCHLCHPNCTYGCIGPGLEGCAASGPKIPSIATGIVGGLLLVLVL
ALSVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPTTSRTPLLSSLSASSNTPTVTCVDRSGSYPLKEESFLQRYSSDPTGALTEDSM
DDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSRSNAVDNPEYLNTT
HPACINGVLDGPALWAQKGSHQISLDNPDYQQAFFPKEAKSNGIFKGPAAENAEYLRAAP
AGSDFTGA
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgcgactctcgcgggcgggccgcgcggcgctcctggtgctgctggccgcgcacttccag
gcgagtctagcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctccagaggatgttcaacaactgtgaggtg
gtccttgggaatttggaaattacctacatgcagagtggttacaacctttcttttctcaag
accatccaggaggttgccggctatgtactcattgccctcaacacagtggagaagattcca
ttggaaaacctgcagatcatccgaggaaatgtgctttatgaaaacacccatgccttagcc
gtcttatccaactatggagcaaacaaaaccggactgagggagctgcccttgagaaactta
caggaaattctgcaaggtgccgtgcgattcagtaacaaccctgtcctctgcaacatggag
accatccagtggcgggacatcatcaacactgattttctaagtaacgtgacaggggacttt
cagaaccagcagggcaactgctcgaagtgtgatccagcctgtctcaacagaagctgctgg
ggtgctggggaggagaactgccagaaattgaccaaaatcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagtgactgctgccacaaccagtgtgccgctggctgc
acggggccacgggagagcgactgcctggtctgccgcaggttccgtgatgaagccacctgc
aaggacacatgtccaccgctcatgctctatgaccctaccacctacgaaatgaaggtcaac
ccgctggggaaatacagctttggcgccacctgtgtcaagaagtgtccccgtaactacgtg
gtgacagaccacggctcgtgcgtccgcgcctgcagctctgacagccaggaggtagaggaa
gatggtgtccgcaagtgcaaaaagtgtgacgggccttgtgccaaagtttgtaacggaata
ggaatcggtgagtttaaagacacactttccataaatgctacaaacattaaacacttcaga
aactgcacatccatcagtggagatcttcatatcctgccagtagcatttaggggggactcc
ttcacacgtactgcacctctggacccgaaagaactggacattctaaaaactgtaaaagaa
ataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctccatgcgttt
gagaacctggaaatcatacgtggcagaacgaagcaacacggccagttttctcttgcggtt
gtcggcctggatataacatccttgggattacgctccctcaaggagataagtgatggcgat
gtgataatttcaggaaatcgaaacttgtgctatgcaaatacgatacactggaaaaaactt
tttgggacctcaactcagaaaaccaaaattttaaacaacaggagtgataaagagtgcaag
gccacgggccatatctgtcacccactgtgctcatcagagggctgctggggacctggaccc
aaatactgcatgtcctgccagaacttcagtcgtggcaaggagtgtgtgggaaagtgcaac
attctagagggagagcccagggagttcgtggagaattccgagtgtgtgcagtgccatcca
gaatgcctgccccaggccatgaatgtgacctgcactggacgcggaccaggcagctgtgtg
aagtgtgcccactacatcgatggccctcactgcgtcaaggcctgccctgctggagtcgcg
ggagagaacggcaccctggtctggaagtttgcagatgccagtcacgtgtgtcacctgtgc
caccccaactgcacctacggctgtatagggccaggtctcgaaggctgtgcagcaagtggg
cccaagatcccgtccattgccacgggcatcgtgggcggcctgctgctggtgttggtgctc
gccctgagcgtcggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgc
cggctgctgcaagagcgtgagctcgtggagcctctgacgcccagcggagaagctcctaac
caagctctcttgaggatcttaaaggagacggaattcaaaaaagtcaaggtgttgggctca
ggagcatttggcaccgtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtagctatcaaggaattaagagaagccacatctcccaaagccaacaaggagattctt
gatgaggcctacgtgatggccagtgtggacaacccacatgtgtgccgcctcctgggcatc
tgcctgacctccacagtgcagctcatcacacagctcatgcccttcggctgcctgctggac
tacgtccgtgagcacaaagacaacatcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaattacctggaagaccggcgcttggtgcacagggacctggcagcc
aggaacgtgctggtgaagacgccgcagcacgtgaagatcacagacttcgggctggccaag
ctgctgggtgccgaggagaaggagtatcacgcggaaggaggcaaggtccctatcaaatgg
atggctttggaatcaattttacaccgaatttatacccatcagagtgatgtctggagctac
ggagtcactgtttgggagttgatgacctttggatccaagccttatgatggaatccctgcg
agtgagatctcgactgtcctggagaaaggagagcgcctcccacagccacccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaag
ttccgtgagttgatccttgaattctccaagatggcccgagacccacagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccctacggactccaacttttaccgcgcc
ctgatggatgaggaggacatggaggacgttgtggatgctgatgagtacctcgtcccccag
cagggcttcttccacagccccaccacctctcggacacccctcctcagctccctgagtgcc
tccagcaacactcccactgtgacttgcgttgatagaagtgggagctaccctctcaaggaa
gaaagcttcctgcagcgctacagttcagaccccactggtgccctcaccgaggacagcatg
gacgacgctttcctcccagtacctgaatatgtaaaccaatctgttcccaaaagacctgca
ggctctgtccagaaccctgtctatcacaatcagcctctatatccagctcctggcagagac
cctcagtaccaaaattcacgcagcaacgccgtggacaaccctgagtatctcaacaccacc
catcctgcctgtatcaatggtgtactcgacggccctgccctctgggctcagaagggcagt
caccaaattagcctagacaaccctgactaccagcaggccttctttcccaaggaagccaag
tcgaatggcatctttaagggacctgcagctgaaaatgcagaatacctgcgggcagcacca
gcaggcagtgactttactggggcctga

DBGET integrated database retrieval system