KEGG   Capra hircus (goat): 102172830
Entry
102172830         CDS       T02910                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04120  Ubiquitin mediated proteolysis
chx04140  Autophagy - animal
chx04144  Endocytosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04722  Neurotrophin signaling pathway
chx05132  Salmonella infection
chx05133  Pertussis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102172830 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102172830 (TRAF6)
   04064 NF-kappa B signaling pathway
    102172830 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102172830 (TRAF6)
   04140 Autophagy - animal
    102172830 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102172830 (TRAF6)
   04621 NOD-like receptor signaling pathway
    102172830 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    102172830 (TRAF6)
   04657 IL-17 signaling pathway
    102172830 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102172830 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102172830 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102172830 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102172830 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102172830 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102172830 (TRAF6)
   05135 Yersinia infection
    102172830 (TRAF6)
   05133 Pertussis
    102172830 (TRAF6)
   05152 Tuberculosis
    102172830 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102172830 (TRAF6)
   05161 Hepatitis B
    102172830 (TRAF6)
   05160 Hepatitis C
    102172830 (TRAF6)
   05171 Coronavirus disease - COVID-19
    102172830 (TRAF6)
   05162 Measles
    102172830 (TRAF6)
   05168 Herpes simplex virus 1 infection
    102172830 (TRAF6)
   05169 Epstein-Barr virus infection
    102172830 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102172830 (TRAF6)
   05140 Leishmaniasis
    102172830 (TRAF6)
   05142 Chagas disease
    102172830 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102172830 (TRAF6)
   04121 Ubiquitin system [BR:chx04121]
    102172830 (TRAF6)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102172830 (TRAF6)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102172830 (TRAF6)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    102172830 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 Tropomyosin_1 zf-RING_5 SlyX Spc29 zf-RING_11 Med21 U-box PspA_IM30 PI3K_P85_iSH2 RNase_Y_N DUF3450 EzrA UPF0242 DUF16 Tropomyosin CENP-Q Sina
Other DBs
NCBI-GeneID: 102172830
NCBI-ProteinID: XP_017914716
UniProt: A0A452ESI6
LinkDB
Position
15
AA seq 573 aa
MWNSENRGPTWIFYRVGVGTPYTRAVDDRVTMSLLHCENSCGSSQSESDCCAAMAASACG
TAAKDDSVGGAASTVTLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHR
FCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHL
EEHQAHCEFALMSCPQCQRPFQKCHLNFHILKECPRRQVPCENCAVLMAFEDKEIHEQNC
PLANVICEYCNTMLIREQMPNHYDLDCPTAPVPCTFSAFGCHEKMQRNHLARHLQENTQS
HMRMMAQAVQTLSLAVAPAPQCTMPPYDSVPPARPSSGRHSEVHNFQETIQQLEGRLVRQ
DHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEE
EKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGT
IRLTILDQSEAAVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIK
DDTLLVRCEVSTRFDMGSLRREGFQPRSTDSGI
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgtggaactctgagaacagagggccaacttggattttttatcgtgtgggagttggcacc
ccttacaccagagcagttgatgatcgcgttactatgagtctgctacactgtgaaaacagc
tgcggatccagccagtccgagagcgactgctgcgccgccatggccgccagcgcctgtggg
accgcagcaaaagacgacagtgtgggcggggcggccagcacggtgactctctccagctcc
tttatggaagagatccagggctacgacgtggaatttgacccacccctggaaagcaagtac
gagtgccccatttgcttgatggctttgcgggaagcagtgcagacaccttgcggccacagg
ttctgcaaagcctgcatcatcaaatcaataagggatgcaggtcacaaatgtccagttgac
aatgaaatacttctggaaaatcaactatttcctgacaattttgcaaaacgagagattctt
tctctgatggtgaaatgtccaaatgaaggttgtttgcacaagatggaactgaggcatctt
gaggagcatcaagcacactgtgagtttgctcttatgagttgtccacaatgccagcgtccc
ttccagaaatgccaccttaattttcatattctcaaggagtgtccaaggagacaggttcct
tgtgaaaactgtgctgtattaatggcatttgaagataaagagattcatgagcagaactgt
cctttggcaaatgtcatctgtgaatactgcaataccatgctcatcagagaacagatgccc
aatcactatgatctagactgtcctacagccccagttccgtgcacattcagtgcttttggt
tgccatgaaaagatgcagaggaatcacttggcacgccacctgcaagagaacacccagtcg
catatgagaatgatggcccaggctgttcagactttaagcctcgcagtggctcctgcacct
cagtgcaccatgcctccgtatgactctgtccctcccgctcggccttcctctgggcgtcac
tcagaagtccacaatttccaagaaaccattcaacagttagagggtcgccttgtaagacaa
gaccatcaaatccgggaactgactgcgaaaatggaaacccagagcatgtatgtgagcgag
ctcaagcgaactattcgaacccttgaggacaaagttgctgaaatagaagcacagcagtgc
aatgggatttatatctggaagattggcaactttgggatgcacttgaaatcgcaagaagag
gagaaacccgttgtcattcacagccccggattctatactggcaaacccggctacaagctg
tgcatgcgcctgcacctgcagctgccgagcgctcagcgctgtgccaactacatatccctc
tttgtccacacgatgcaaggggagtacgacagccacctgccttggcccttccagggaacg
atccgccttacaatccttgatcagtctgaagcagctgtgaggcaaaaccacgaagaaata
atggacgccaaaccagagctcctggcctttcagagacccaccatcccccggaaccccaag
ggttttggctacgtgacttttatgcatctggaagccctcagacaaagaaccttcatcaag
gatgacacgttattagtacgctgtgaggtctccacccgcttcgacatgggcagtcttcgg
agggagggttttcagccacggagtactgactcagggatatag

DBGET integrated database retrieval system