KEGG   Capra hircus (goat): 102172845
Entry
102172845         CDS       T02910                                 

Gene name
BCL2A1
Definition
(RefSeq) BCL2 related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
chx  Capra hircus (goat)
Pathway
chx04064  NF-kappa B signaling pathway
chx04210  Apoptosis
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102172845 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102172845 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102172845 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102172845 (BCL2A1)
SSDB
Motif
Pfam: Bcl-2 CCDC24
Other DBs
NCBI-GeneID: 102172845
NCBI-ProteinID: XP_005695116
LinkDB
Position
21
AA seq 206 aa
MFRQAPQACASDCLGHLQVSRLKTLLPSKENMTDTEFDYVHKLAEDYLKYVLQIQQPGSK
PSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFEDGIVNWGRI
VTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEFITENTGEWIRQNGGWENGFVKKFE
TKSGWLTFLEVTGKICETLCRLKQYY
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtttcgccaggctccacaagcttgtgcttcagactgtcttggtcacttgcaggtgagc
aggctcaagacgctactccccagcaaggagaacatgactgacactgagtttgactacgtt
cacaagctggctgaggactatctgaaatatgtgttgcagatacagcaacctggatccaag
ccaagcaaaacatccagggtgttacaagacgtggcttcctctgtccaggacgaagtggaa
aggactttgaagcagtgcttggataagtttgatgtggtgtctgtagacactgccagaaca
atattcaaccaagtgatggaaaaggaatttgaagatggcattgttaactggggcaggatt
gtaaccatattcgcctttgaaggtattcttaccaagaaacttctgagcaagcgtattgcc
tcagacatggacatgtgcaaggacatttcttatttcgtggcggagtttatcaccgaaaac
acaggagagtggataaggcaaaacggaggctgggaaaatgggtttgtaaagaagtttgaa
accaaatctggctggctgacttttctggaagttacaggaaagatctgtgaaacattatgt
cgtctgaagcaatactattga

DBGET integrated database retrieval system