KEGG   Capra hircus (goat): 102172881
Entry
102172881         CDS       T02910                                 

Gene name
CD38
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
chx  Capra hircus (goat)
Pathway
chx00760  Nicotinate and nicotinamide metabolism
chx01100  Metabolic pathways
chx04020  Calcium signaling pathway
chx04640  Hematopoietic cell lineage
chx04921  Oxytocin signaling pathway
chx04970  Salivary secretion
chx04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102172881 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102172881 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102172881 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102172881 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    102172881 (CD38)
   04972 Pancreatic secretion
    102172881 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    102172881 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102172881 (CD38)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102172881 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102172881 (CD38)
CD molecules [BR:chx04090]
 Proteins
  102172881 (CD38)
Glycosaminoglycan binding proteins [BR:chx00536]
 Hyaluronan
  Cell surface receptors
   102172881 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse YjeJ
Other DBs
NCBI-GeneID: 102172881
NCBI-ProteinID: XP_005681969
UniProt: A0A452DQ25
LinkDB
Position
6
AA seq 277 aa
MADCCTGKKLCYCLLLCFLVAGIIGGAIGIHKWYHSGLNRWHGLGSTADFQKIIQERCDT
YPQQIWSYSRSRNCQEIKQAFMSAFISKDPCKATKEDYRRLIDLADSTVPCNKRVLWSKT
KELAGEYAKVRGLVTLEDTLLGSLADGLSWCGEPGSSDLNTWSCPDWKKDCRTNYLTVFW
EVLSERFAESACGTVQVVLDGSLENAFNEMSIFGRVEAPNLKPVVTLQAWLVHDPGKPPR
DSCSGSSIMKLKSILSERNVRFICRDNLSRDEFLGRF
NT seq 834 nt   +upstreamnt  +downstreamnt
atggccgactgctgcacgggaaagaagctttgctactgccttcttctgtgcttcctggtg
gcggggatcatcgggggggcgatcggaatccacaagtggtaccactccgggctcaacagg
tggcacgggctaggcagcaccgccgattttcagaaaatcatccaagagcgatgcgacacc
tacccccagcagatctggtcgtattccagaagcagaaactgccaagagatcaagcaggca
ttcatgagtgcattcatttccaaggatccctgcaaagcgacaaaggaagactacagacga
ctgatcgacctggcagattccactgtgccttgcaacaagagagtcttatggagcaaaaca
aaggagctggctggtgaatacgcgaaagtgcggggcctggtgaccctggaggacacactg
ctgggttcccttgcagacggcctcagctggtgtggagagccaggctcttctgatttgaac
acgtggtcttgtccagactggaagaaagactgcagaacaaactatcttactgtattctgg
gaagtgctgtccgaaaggtttgcagaaagtgcctgtggtacagtccaggtggtgctcgac
gggtcgctcgagaacgcctttaatgaaatgagcatatttggacgagtggaagcccctaac
ttgaagccagtggttacactacaggcttggctggtacatgaccctggaaaacctccccgt
gactcatgctctggctcctctataatgaaactgaagtccatcttaagtgaaagaaatgtc
agatttatctgcagggataatctcagccgggacgagtttcttggaagattctga

DBGET integrated database retrieval system