KEGG   Capra hircus (goat): 102173368
Entry
102173368         CDS       T02910                                 

Gene name
TKFC, DAK
Definition
(RefSeq) triokinase and FMN cyclase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
chx  Capra hircus (goat)
Pathway
chx00051  Fructose and mannose metabolism
chx00561  Glycerolipid metabolism
chx01100  Metabolic pathways
chx01200  Carbon metabolism
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102173368 (TKFC)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102173368 (TKFC)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102173368 (TKFC)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     102173368 (TKFC)
    2.7.1.29  glycerone kinase
     102173368 (TKFC)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     102173368 (TKFC)
SSDB
Motif
Pfam: Dak1 Dak2
Other DBs
NCBI-GeneID: 102173368
NCBI-ProteinID: XP_013831362
UniProt: A0A452FQK7
LinkDB
Position
29
AA seq 578 aa
MTSKKLVNSVAGCADDALAGLVACNPSLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVVGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEITDR
VSVVAKAMGTLGVSLSSCSVPGSKPTFELAADEVELGLGIHGEAGVRRIKMAPADEIVAL
MLDHMTSSSNASHVPVQPGSSVVLMVNNLGGLSFLELGIIADAAVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTASAWPNMAKVWVTGRKRSRAAPTEPLAA
PDSTAAAGAASKQTVLVLERVCTTLLGLEEHLNALDRAAGDGDCGSTHSRAARAIQGWLK
EGPPPASPAQLLSKLSFLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLPAWSAAMDAGLA
AMQKYGKAAPGDRTMLDSLWAAGQELQAWRSPGANLLQILTKAVKSAEAAAEATKNMEAG
AGRASYISSARLDQPDPGAVAAAAILRAILEVLQSQGV
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgacctccaagaagctagtgaactcagtggcaggctgtgccgacgacgctcttgccggc
ctggtggcctgcaaccccagcctacagctcctgcagggccaccgtgtggctctccgttct
gatctggacagtctcaagggccgcgtggccctactgtcgggtgggggctccggccatgag
cctgcccatgctggtttcatagggaaggggatgctgacgggggtcattgcaggagctgtg
ttcacctccccggcagtgggcagcatcctggcggctatcagggccgtggcccaggcgggc
acagtggggaccctcctcatcgtgaagaactacaccggggaccggctcaactttggcctg
gcccgggagcaggcccgggcggagggcatccctgtggagatggtggtcgtcggggacgac
agtgccttcaccgtcctgaagaaggcaggccggcgtgggctctgtggcacagtgctcata
cacaaggtggcgggtgctctggccgaggcaggtgtgggactggaggagatcacagatcgg
gtgagcgtggtcgccaaggccatgggaaccctgggagtgagcttgtcctcctgcagcgtc
cctggttccaaacccacttttgagctcgcagctgatgaggtggagctgggcctggggatc
catggggaagctggcgtgcgccggataaagatggcgcctgccgacgagatcgtggcgctc
atgctggaccacatgacgagctcctccaacgcatcccacgtgcctgtgcagcccggctcc
tcagtagtgctgatggtcaacaacctgggtggcctgtcatttctggaactgggcatcata
gctgacgccgccgtccgctctctggagggccgcggggtgaagatcgcccgtgccctagtg
ggcaccttcatgtcagctctggagatgcctggcatttctctcaccctcctgctggtggat
gagcccctcctgaaactgatagatgctgaaaccactgcctcggcctggcccaacatggcc
aaggtctgggtgactgggcggaagcggagccgggccgcccccacggagcccctggcagcc
cctgactccactgctgcagcaggtgcagcctcgaagcagacggtacttgtgctggagcgg
gtgtgcactaccctcctgggcctggaggagcatctgaacgccctggaccgcgctgccggt
gatggggactgtggctccacccacagccgtgcagccagagctattcaggggtggctaaag
gaaggcccacccccagccagccctgcccagctactctccaaattgtccttcctgctactg
gagaagatgggaggctcctcaggggcgctctacggcctgttcctgactgcagcggcccag
ccactcaaggccaagactgacctcccagcctggtctgctgccatggatgctggcctggcg
gccatgcagaagtacggaaaggctgccccaggtgacaggactatgctggattctctttgg
gcagcaggacaggagctccaagcctggaggagcccaggggccaatctgctccagattctg
accaaggctgtcaagagtgcagaagctgcagccgaggccaccaagaacatggaagctgga
gctggaagagccagttacatcagctccgcgcgcctggatcagccagaccccggggcggtg
gcagccgcggccattctgcgtgccatcttggaggtcttgcagagtcagggtgtgtga

DBGET integrated database retrieval system