KEGG   Capra hircus (goat): 102173379Help
Entry
102173379         CDS       T02910                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04020  Calcium signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04114  Oocyte meiosis
chx04140  Autophagy - animal
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04340  Hedgehog signaling pathway
chx04371  Apelin signaling pathway
chx04530  Tight junction
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04727  GABAergic synapse
chx04728  Dopaminergic synapse
chx04740  Olfactory transduction
chx04742  Taste transduction
chx04750  Inflammatory mediator regulation of TRP channels
chx04910  Insulin signaling pathway
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04976  Bile secretion
chx05012  Parkinson disease
chx05020  Prion diseases
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05034  Alcoholism
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102173379 (PRKACA)
   04010 MAPK signaling pathway
    102173379 (PRKACA)
   04310 Wnt signaling pathway
    102173379 (PRKACA)
   04340 Hedgehog signaling pathway
    102173379 (PRKACA)
   04371 Apelin signaling pathway
    102173379 (PRKACA)
   04020 Calcium signaling pathway
    102173379 (PRKACA)
   04024 cAMP signaling pathway
    102173379 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102173379 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102173379 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102173379 (PRKACA)
   04540 Gap junction
    102173379 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102173379 (PRKACA)
   04062 Chemokine signaling pathway
    102173379 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102173379 (PRKACA)
   04910 Insulin signaling pathway
    102173379 (PRKACA)
   04922 Glucagon signaling pathway
    102173379 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102173379 (PRKACA)
   04912 GnRH signaling pathway
    102173379 (PRKACA)
   04913 Ovarian steroidogenesis
    102173379 (PRKACA)
   04915 Estrogen signaling pathway
    102173379 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102173379 (PRKACA)
   04921 Oxytocin signaling pathway
    102173379 (PRKACA)
   04926 Relaxin signaling pathway
    102173379 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102173379 (PRKACA)
   04918 Thyroid hormone synthesis
    102173379 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102173379 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102173379 (PRKACA)
   04916 Melanogenesis
    102173379 (PRKACA)
   04924 Renin secretion
    102173379 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102173379 (PRKACA)
   04927 Cortisol synthesis and secretion
    102173379 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102173379 (PRKACA)
   04270 Vascular smooth muscle contraction
    102173379 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102173379 (PRKACA)
   04971 Gastric acid secretion
    102173379 (PRKACA)
   04976 Bile secretion
    102173379 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102173379 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102173379 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102173379 (PRKACA)
   04727 GABAergic synapse
    102173379 (PRKACA)
   04725 Cholinergic synapse
    102173379 (PRKACA)
   04728 Dopaminergic synapse
    102173379 (PRKACA)
   04726 Serotonergic synapse
    102173379 (PRKACA)
   04720 Long-term potentiation
    102173379 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102173379 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102173379 (PRKACA)
   04742 Taste transduction
    102173379 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102173379 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102173379 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102173379 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102173379 (PRKACA)
   04714 Thermogenesis
    102173379 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102173379 (PRKACA)
   05205 Proteoglycans in cancer
    102173379 (PRKACA)
   05203 Viral carcinogenesis
    102173379 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102173379 (PRKACA)
   05020 Prion diseases
    102173379 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102173379 (PRKACA)
   05031 Amphetamine addiction
    102173379 (PRKACA)
   05032 Morphine addiction
    102173379 (PRKACA)
   05034 Alcoholism
    102173379 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102173379 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102173379 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102173379 (PRKACA)
   05163 Human cytomegalovirus infection
    102173379 (PRKACA)
   05165 Human papillomavirus infection
    102173379 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102173379 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102173379 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102173379 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chx03019]
    102173379 (PRKACA)
   03036 Chromosome and associated proteins [BR:chx03036]
    102173379 (PRKACA)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102173379 (PRKACA)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: AGC group
  PKA family
   102173379 (PRKACA)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102173379 (PRKACA)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102173379 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102173379
NCBI-ProteinID: XP_017906682
LinkDB All DBs
Position
7
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHTETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagtgagcaagagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaacacagcccac
ttggatcagtttgaacgaattaagaccctgggcacgggctccttcgggcgggtgatgctg
gtgaagcacacggagaccgggaaccactacgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagattgagcacaccctgaacgagaagcgcatcctgcaggcggtcaac
tttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatggtc
atggagtacgtgcccggtggggagatgttctcacacctgcgacggatcgggaggttcagt
gagccccacgcgcgcttctacgccgcccagattgtcctgacctttgagtacctgcactcg
cttgatctcatctaccgggacctgaagccggagaacctcctcatcgaccagcagggctac
attcaggtgacagacttcggttttgccaagcgtgtgaaaggccgcacctggaccttgtgt
gggacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggtcctcatctatgaaatggccgcaggctacccccccttcttc
gccgaccagcccatccagatctacgagaagattgtctctgggaaggtgcggtttccatcc
cacttcagctctgacttgaaggatctgctgcgcaacctcctacaagtggatctcaccaag
cgctttgggaacctcaagaatggggtcaatgatataaagaaccacaagtggtttgccaca
actgactggattgccatctaccagagaaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacaagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttctag

DBGET integrated database retrieval system