KEGG   Capra hircus (goat): 102173973
Entry
102173973         CDS       T02910                                 

Gene name
PML
Definition
(RefSeq) promyelocytic leukemia
  KO
K10054  probable transcription factor PML
Organism
chx  Capra hircus (goat)
Pathway
chx04120  Ubiquitin mediated proteolysis
chx04144  Endocytosis
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102173973 (PML)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102173973 (PML)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102173973 (PML)
   05202 Transcriptional misregulation in cancer
    102173973 (PML)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102173973 (PML)
  09172 Infectious disease: viral
   05164 Influenza A
    102173973 (PML)
   05168 Herpes simplex virus 1 infection
    102173973 (PML)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102173973 (PML)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    102173973 (PML)
SSDB
Motif
Pfam: DUF3583 zf-B_box zf-RING_5 zf-C3HC4 Prok-RING_4 APG17 OmpH
Other DBs
NCBI-GeneID: 102173973
NCBI-ProteinID: XP_005695206
UniProt: A0A452DYU0
LinkDB
Position
21
AA seq 868 aa
MQQDPEPAGSPGPQQDPALPHSPSMPPPESLSEGHQSSHSDSPTEQATEEEFQFLRCQGC
RAEAKCPKLLPCLHTLCSGCLEESGIQCPVCQAPWPSGAGAQALDNVFFESLQRRLSVYQ
QIAREQAFCTRCKELAHYWCFECEQLICAKCFEAHQWFLKHEARPLAELRSQSVREFLDG
TRKSNNIFCSNPNHRSPMLTSIYCRGCSKPLCCSCALLDRDHGELKCDISMEIQQRQDEL
DTMTQDLQEQDRSFGAAQAQMRSAISQLGRVRADTEEFIRERVREVVAHVLEQERELLEG
VGARYQRDYEEIAGQLGRLDAVLQRIRMGSVLVQRMKLYASDQEVLDMHDFLRKALHQLR
QEEPQSLRATVHTDSFNEFRVRLQGLVSCITQGRDAALSRRASPEAASTPRDTCGPDPPE
EVPRDQMQAAGLAVVQPVPGAHPVPVYAFSIQDPSRREEGTHTQKRKACQTECPRKVIKM
ESEEGEESRLAQSSPEQPRPSTSRAVSPPHLDGPSSPKSPIIRDELPLPESNHQTGDPAE
TEERVVVISSSEDSDAENPDSRELADNSSESSDLQLEGPSSLAVLDDGLSNSLVEDKPLV
FFDLKIDNETQKISQLAAVNQESQFRALIQPEALNVYSKAVSLEVGLQHFLYFLASMHQP
ILACYKLWGPSLPSFFQALEEMNMLGKFQKSISGFLATLPLIRECVPGASSFKLKSLAKT
YLARNMSERSALAAVLAMRDLCRLLEVSPGPQLAPHIHPFSSLQCFSSLQPLVQAAILPR
AEARLLALHKVTFIELLTAHHHDPQGGLKKYNRFLSLQTPTSSQPALDLQSLGTYFEGLL
GEPASAGAGGVAAPPAGHSLAERATQQT
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcagcaggatccggagcctgccggatctccggggccccagcaggaccccgcactgccc
cactcccccagcatgcctcccccggagtcactctccgaaggccaccagtccagccacagc
gacagccccacagagcaagccacggaggaagagttccagttcttgcgctgccagggctgc
cgggcagaagctaagtgccccaagctgctgccttgtctgcacacgctgtgctcaggatgc
ctggaggagtccggcatacagtgccccgtctgccaggctccctggccctcaggtgccggc
gcgcaggccctggacaacgtcttcttcgagagcctgcagcggcggctgtcggtgtaccag
cagatcgcacgcgagcaggcgttttgcacccgctgcaaagagttggcccactactggtgc
ttcgagtgtgagcagctcatctgcgccaagtgcttcgaggcgcaccagtggttcctcaag
cacgaggcccggccgctggcggagctccgcagccagtccgtgcgggagtttctggacggc
acccgcaagtccaacaacatcttctgctccaaccccaaccaccgcagccctatgctgacc
agcatctactgccgaggctgctccaagcccttgtgctgctcgtgcgctctcctggatagg
gaccatggcgagctcaagtgcgacatcagcatggagatccagcagcggcaggatgagctg
gacaccatgacccaggacctgcaggagcaggaccgcagcttcggggcagcgcaggcgcag
atgcgctctgccatcagccagctgggccgcgtacgcgccgacactgaggagttcatccgt
gagcgcgtgcgcgaggtggtagcgcacgtgctagagcaggagcgtgagctgctggaaggc
gtgggtgcgcggtaccagcgcgactatgaagagatagcgggccagctgggccggctggat
gctgtactgcagcggatccgtatgggcagcgtgctggtgcagaggatgaaactatacgcc
tcggatcaggaggtgctggacatgcatgacttcctgcgcaaggcactccaccagctgcgc
caagaggagccccagagtctgcgagccacggtgcacacagacagcttcaacgaattcagg
gtgcgcctgcagggcctcgtctcttgcatcacccagggtagagatgcagctctatccagg
agagccagcccagaagctgccagcactcccagagacacttgtggtcctgacccgccagag
gaggtgccgagggaccagatgcaagccgcgggattggccgtggtacagccggtgccaggg
gcacaccctgtgccagtgtacgccttctccatccaagacccctcccgcagagaagagggc
acccacacgcagaagaggaaggcctgccagaccgagtgcccccggaaggtcatcaagatg
gagtctgaggagggggaagagtctaggttggctcagagctcccctgagcagcccaggccc
agcacctccagggcagtctcgccaccccacctggatgggccctccagccccaagagcccc
atcataagagatgagctccccttgcctgagagcaaccatcaaaccggcgaccctgcagag
acagaggagcgcgtcgtggtgatcagcagctcggaagactcagatgctgaaaacccggac
tcccgagagctggccgacaacagcagcgagtccagtgacctccagctggagggccccagc
tccctcgcagtcctggacgacggcctctccaactccctggtggaagacaagcccctggtt
ttctttgacctcaagattgacaatgaaacccagaagattagccagctggcagccgtgaac
caggaaagccagttccgcgcgctcatccagcccgaggcgctcaacgtgtactccaaggct
gtctccctagaggtgggactgcagcacttcctgtacttcctggcgagcatgcaccagccc
atcctggcctgctataagctgtggggacccagtctccccagcttcttccaggccctggag
gagatgaacatgctggggaagttccagaagtccatctcgggcttcctggccaccctgccc
ctcatccgggagtgcgtgccgggggccagcagcttcaaactcaagagcctggccaagacc
tacctggcaagaaacatgagcgaacgcagcgccctcgcggccgtgctggccatgcgcgac
ctgtgccgactcctcgaggtgtcccccggcccccagctggccccgcacatccaccccttc
agcagcctgcagtgcttctcatccctgcagcccctggtgcaggcggccatcctgccccgg
gccgaggcccgcttgctggccctccacaaggtcaccttcatagagctgctgaccgcacac
caccatgacccccagggcggcctgaagaagtacaaccgcttcctgagcctccagactccc
acgtcgtcccagcctgcactcgacctgcagtctctgggcacctacttcgaaggcctgctg
ggggagccggcctcggcaggggcaggaggcgtcgctgcccctccggctggccacagcttg
gcagaaagggctacgcagcagacctga

KEGG   Capra hircus (goat): 102188350
Entry
102188350         CDS       T02910                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04659  Th17 cell differentiation
chx04915  Estrogen signaling pathway
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102188350 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102188350 (RARA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188350 (RARA)
   05202 Transcriptional misregulation in cancer
    102188350 (RARA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102188350 (RARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102188350 (RARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:chx03310]
    102188350 (RARA)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102188350 (RARA)
Nuclear receptors [BR:chx03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   102188350 (RARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102188350
NCBI-ProteinID: XP_017920520
UniProt: A0A452EMU9
LinkDB
Position
19
AA seq 462 aa
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQAGSGGRDGGGLAAPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccaacacctgggggagggcacctcaatgggtacccg
gtgcccccctacgccttcttcttcccccccatgctgggtggactctcccccccaggcgct
ctgaccactctccagcaccagcttccagtgagcggctatagcacgccatccccagccacc
atcgagacccagagcagcagttccgaagagatcgtgcccagccccccctcgccgcctcct
ctcccccgcatctacaagccttgctttgtctgtcaagacaaatcctcaggctaccactat
ggggtcagcgcctgtgagggttgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgttgc
cagtactgtcggctgcagaagtgcttcgaagtgggcatgtccaaggagtccgtgagaaat
gaccggaacaagaagaagaaggaggtgcccaagcccgagtgctccgagagctacacgttg
acaccagaggtgggggagctcatcgagaaggtgcgcaaagcgcatcaggagaccttccct
gcgctctgccaactgggcaaatacactacgaacaacagctcagaacagcgtgtctccctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcaactgcccggcttcaccaccctcaccattgcggaccagatcaccctc
ctcaaggctgcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacacgatgaccttctcggacgggctgaccctgaaccggacccagatgcacaacgcc
ggctttggcccactcacggacctggtcttcgccttcgccaaccagctgctgcccctggag
atggatgacgctgagactgggttgctcagcgccatctgcctcatctgtggagaccggcag
gacctggagcagccagacagggtggacatgctgcaggagccgctgcttgaggcactgaag
gtctatgtgcggaaacggaggcccagccgcccacacatgttccccaagatgctgatgaag
atcacagacctccggagcatcagtgctaagggggctgagcgagtgatcacgctgaagatg
gagattccgggctccatgccacctctcatccaggaaatgctggagaactcagagggtctg
gacactctgagcggacaagcggggagtggggggcgggatgggggcggcctggctgccccg
cccggcagctgtagccccagcctcagccccagctcaaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system