KEGG   Capra hircus (goat): 102173987
Entry
102173987         CDS       T02910                                 

Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
chx  Capra hircus (goat)
Pathway
chx04145  Phagosome
chx04380  Osteoclast differentiation
chx04613  Neutrophil extracellular trap formation
chx04640  Hematopoietic cell lineage
chx04666  Fc gamma R-mediated phagocytosis
chx05140  Leishmaniasis
chx05150  Staphylococcus aureus infection
chx05152  Tuberculosis
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
chx05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102173987
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102173987
   04613  Neutrophil extracellular trap formation
    102173987
   04666 Fc gamma R-mediated phagocytosis
    102173987
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102173987
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102173987
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102173987
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102173987
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102173987
   05152 Tuberculosis
    102173987
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102173987
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102173987
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    102173987
Membrane trafficking [BR:chx04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    102173987
CD molecules [BR:chx04090]
 Proteins
  102173987
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set
Other DBs
NCBI-GeneID: 102173987
NCBI-ProteinID: XP_017901508
LinkDB
Position
3
AA seq 371 aa
MWLMIALILGAPVAEQVDPTKAVITLKPPWVSVFQEENVTLLCEGPHLPGDTATQWFLNG
TAIKTLAPRYSVNGATFDDSGEYKCQTGLSMPSDPVQLEVHSDWLLLQVSSRVFLEGDPL
VLRCHAWKNMEVYRMLFYKDGKSFWFSNRDSEFTILKTNLSHNGIYHCSGERRRRYTSAG
VSITIKELFPAPVLRTSFSSPHQEGNLVNLSCETKLPSEKPGLQLYFSFYVGNKTLMSRT
TSSEYQTFIAKTEDPGLYWCEAATEDGNLIKRSPELELPVLGLQSTTPVWFHFLFYPAVG
IMFLVDSALCIVIHKELQRKKMWNLEIYLDSLDSGHGKKVPPTFKNIDNXKTKWKRQKQE
QLQERTHEEKP
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgtggctcatgatagctctgatccttggggctccagttgctgagcaagtggaccccaca
aaggcagtgatcaccttgaagcctccatgggtcagtgtattccaagaagaaaatgtaacc
ttattgtgtgaggggccccacctgcctggggacaccgctacacagtggtttctcaatggc
acagccatcaagaccctggcccccagatacagtgttaatggtgctacattcgatgacagt
ggtgaatacaagtgccagacaggcctctcaatgccaagtgacccagtacagctagaagtc
cacagtgattggctactactccaggtctctagcagagtcttcttagaaggggaccctctg
gtcttgaggtgtcatgcatggaagaatatggaggtgtacagaatgcttttctacaaagat
ggcaagtccttttggttttctaatcgggattctgaattcaccattctgaaaaccaacttg
agtcacaacggcatctatcactgctcgggtgagagaaggcgtcgctacacatcagcagga
gtatctatcactataaaagagctatttccagccccagtgctgagaacatccttctcatcc
cctcaccaagaggggaatctggtcaacctgagctgtgaaacaaagttgccctcagagaag
cctggtctgcagctttacttctccttctatgtgggaaacaagaccctaatgagcaggacc
acatcctctgaataccagacattcattgctaaaacagaagaccctgggctatactggtgt
gaagctgccacagaagatggaaatcttatcaagcgcagccccgagctggagcttccagtg
cttggcctccagtcaacaactcctgtctggtttcattttcttttctatccggcagtgggg
ataatgtttttggtggacagtgctttatgtattgtaatacataaggaactacaaagaaag
aaaatgtggaatttagagatctatttggactctctggactctggtcatgggaagaaggta
cctcctaccttcaaaaacatagacaatnntaaaacaaagtggaaacgtcagaaacaagaa
caactgcaagaaaggacacacgaggagaagccttga

DBGET integrated database retrieval system