KEGG   Capra hircus (goat): 102173997
Entry
102173997         CDS       T02910                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04115  p53 signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04932  Non-alcoholic fatty liver disease
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05134  Legionellosis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05222  Small cell lung cancer
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102173997
   04215 Apoptosis - multiple species
    102173997
   04115 p53 signaling pathway
    102173997
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102173997
  09162 Cancer: specific types
   05210 Colorectal cancer
    102173997
   05222 Small cell lung cancer
    102173997
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102173997
   05012 Parkinson disease
    102173997
   05014 Amyotrophic lateral sclerosis
    102173997
   05016 Huntington disease
    102173997
   05017 Spinocerebellar ataxia
    102173997
   05020 Prion disease
    102173997
   05022 Pathways of neurodegeneration - multiple diseases
    102173997
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102173997
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102173997
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102173997
   05134 Legionellosis
    102173997
   05152 Tuberculosis
    102173997
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102173997
   05161 Hepatitis B
    102173997
   05160 Hepatitis C
    102173997
   05164 Influenza A
    102173997
   05162 Measles
    102173997
   05168 Herpes simplex virus 1 infection
    102173997
   05163 Human cytomegalovirus infection
    102173997
   05167 Kaposi sarcoma-associated herpesvirus infection
    102173997
   05169 Epstein-Barr virus infection
    102173997
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102173997
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102173997
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 102173997
NCBI-ProteinID: XP_017902567
UniProt: A0A0C4Y1X3
LinkDB
Position
4
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggagggaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaacaaaaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaaccaag
atgatctttgctggcattaagaagaagggagagagggaggacttgatagcttatctcaaa
aaagctaccaatgagtaa

KEGG   Capra hircus (goat): 106501717
Entry
106501717         CDS       T02910                                 

Definition
(RefSeq) cytochrome c 2
  KO
K08738  cytochrome c
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04115  p53 signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04932  Non-alcoholic fatty liver disease
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05134  Legionellosis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05222  Small cell lung cancer
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106501717
   04215 Apoptosis - multiple species
    106501717
   04115 p53 signaling pathway
    106501717
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106501717
  09162 Cancer: specific types
   05210 Colorectal cancer
    106501717
   05222 Small cell lung cancer
    106501717
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106501717
   05012 Parkinson disease
    106501717
   05014 Amyotrophic lateral sclerosis
    106501717
   05016 Huntington disease
    106501717
   05017 Spinocerebellar ataxia
    106501717
   05020 Prion disease
    106501717
   05022 Pathways of neurodegeneration - multiple diseases
    106501717
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106501717
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106501717
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106501717
   05134 Legionellosis
    106501717
   05152 Tuberculosis
    106501717
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106501717
   05161 Hepatitis B
    106501717
   05160 Hepatitis C
    106501717
   05164 Influenza A
    106501717
   05162 Measles
    106501717
   05168 Herpes simplex virus 1 infection
    106501717
   05163 Human cytomegalovirus infection
    106501717
   05167 Kaposi sarcoma-associated herpesvirus infection
    106501717
   05169 Epstein-Barr virus infection
    106501717
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106501717
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106501717
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 106501717
NCBI-ProteinID: XP_005675975
UniProt: A0A452G617
LinkDB
Position
2
AA seq 105 aa
MADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIW
GEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atggcagatgctgaggcaggcaagaagatctttattcaaaaatgtgctcagtgccacaca
gtggagaaaggtggaaaacacaagactggtccaaatctctggggcctttttggcagaaaa
acaggacaagcgccaggattttcttataccgaggcaaacaaaaacaaaggcattatctgg
ggagagcagactttgatggaatatttggagaacccaaagaaatatatccctggaactaaa
atgatctttgctggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa
caggcaacatcttcatga

DBGET integrated database retrieval system