KEGG   Capra hircus (goat): 102174007
Entry
102174007         CDS       T02910                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04072  Phospholipase D signaling pathway
chx04144  Endocytosis
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04630  JAK-STAT signaling pathway
chx04810  Regulation of actin cytoskeleton
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
chx05206  MicroRNAs in cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102174007 (PDGFRA)
   04014 Ras signaling pathway
    102174007 (PDGFRA)
   04015 Rap1 signaling pathway
    102174007 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102174007 (PDGFRA)
   04020 Calcium signaling pathway
    102174007 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102174007 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102174007 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102174007 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102174007 (PDGFRA)
   04540 Gap junction
    102174007 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102174007 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174007 (PDGFRA)
   05206 MicroRNAs in cancer
    102174007 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102174007 (PDGFRA)
   05231 Choline metabolism in cancer
    102174007 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102174007 (PDGFRA)
   05218 Melanoma
    102174007 (PDGFRA)
   05215 Prostate cancer
    102174007 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102174007 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102174007 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102174007 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    102174007 (PDGFRA)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102174007 (PDGFRA)
Protein kinases [BR:chx01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102174007 (PDGFRA)
CD molecules [BR:chx04090]
 Proteins
  102174007 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 Kinase-like LAT
Other DBs
NCBI-GeneID: 102174007
NCBI-ProteinID: XP_005681684
UniProt: A0A452DR61
LinkDB
Position
6
AA seq 1089 aa
MGISHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGVVHASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYQCAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTVVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITEVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggatttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagcgcctcggcggcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcagacatatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcagtcatcatcccatgccgcacaacggatcctgagactccggtgacc
ttactcagcagtgagggggtagtgcatgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacggtcagagggaagaagttccagacc
atcccattcaatgtttatgcgtacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtatataaggcaggcgaatcgattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcaatggacttaccctggacaaatgaagggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcctgaggcc
acagtgaaagacagtggagattaccaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagagaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagtggccattatactgttgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccgtcctccatactggacttg
gttgacgaccaccatggctctaacgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaacgaaact
tcatggacggttttggccaacaacgtttcaaacatcatcacagaggtccacccccgagac
aggagcacagtggaaggccaggtgacgtttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcagctgcagtcctggtgttgttggtgattgtaatcatc
tcgctcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcgtttgggaaagtggttgaaggaactgcctatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacatcgtgaacttg
ctgggtgcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagagacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttat
gttatcttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagca
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggcctgactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggctcaagggaaaatcgtgaagatctgtgactttggcctggcc
cgagacatcatgcatgactcgaactacgtgtccaaaggcagtacctttctccccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggagatcttttcccttggtggcacaccctaccctggcatgatg
gtggattctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccgtccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agctatgaaaagatccacctggactttctgaagagtgaccaccccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaagaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagtggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system