KEGG   Capra hircus (goat): 102174153Help
Entry
102174153         CDS       T02910                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
chx  Capra hircus (goat)
Pathway
chx03030  DNA replication
chx03410  Base excision repair
chx03420  Nucleotide excision repair
chx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:chx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102174153 (LIG1)
   03410 Base excision repair
    102174153 (LIG1)
   03420 Nucleotide excision repair
    102174153 (LIG1)
   03430 Mismatch repair
    102174153 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:chx03032]
    102174153 (LIG1)
   03400 DNA repair and recombination proteins [BR:chx03400]
    102174153 (LIG1)
Enzymes [BR:chx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102174153 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102174153 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102174153 (LIG1)
DNA replication proteins [BR:chx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102174153 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102174153 (LIG1)
DNA repair and recombination proteins [BR:chx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102174153 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102174153 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     102174153 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 DDR PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 102174153
NCBI-ProteinID: XP_017918174
LinkDB All DBs
Position
18
AA seq 914 aa AA seqDB search
MQRSIRSFFQPKKEGKVKKPEKETSNTIRETESPPKVALKERNRVVSDGDSPVKRPGRKA
TRVLGSEGEEEEEEAPTTPRSQEPASDSPQPSPPSPVTLPESSPSRSKPSPAAASPSGIP
KRRTARKQLPKRTFQDVLKEQGEDEDPETKKKKEEGEAETPTESLPEPEGGDKEEVGDQP
TTPPEPQTSTESPTESVSEPGVTVKQEPQEDGQAQPPPKAPKTLSSFFSPRKPAVKKEAK
EEGPGALRKDETKGHLDPPSYNPAKNNYHPIEDACWKAGQRVPYLAVARAFEKIEEVSAR
LRMVETLSNLLRSVVALSPADLLPVLYLSLNRLGPPQQGLELGIGEGILLKAVAQATGRQ
LESVRAEVAEKGDVGLVAESSRSTQRLVLPPPALTAAGVFAKFRDIAQLAGSASTTKKMD
VIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQECPPAVVDAGK
GKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSPGVPLKPMLA
HPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRYPDIISRI
PKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYL
NGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTEQIAEFLEQSVKDSCEGLMVK
TLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGRYGGFLLASYDE
ESEEFQAICKLGTGFSDEELEEHHQRLQALVLPTPRSYVRADGAVAPDHWLDPSDVWEVK
CADLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEQATTSAQVAGLYKKQSQIQN
QQGAEPDSEQEEFY
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcaggtcatttttccagcccaagaaagagggcaaagtgaagaagcca
gagaaggagacatccaacaccatcagagaaacggagtcccctccaaaggtggcactgaag
gagcggaatcgagtggtgtctgacggtgactctccagtgaagaggccggggaggaaggca
accagggtcctgggcagcgagggcgaggaggaggaagaggaagcccccaccacccccaga
agccaggagcctgcttcagactctccacagccctcacctcccagtcctgtcaccctgcct
gagagcagcccttcccgctccaagccctccccagcggctgcgtccccatcagggatcccg
aagcggcgcacggcccggaagcagcttcccaaacggacatttcaagatgtcctgaaagag
cagggcgaggacgaggacccagagactaagaagaagaaggaggaaggagaagcagagaca
ccaacagaaagcctcccagagcctgaagggggcgacaaggaggaagtgggggaccagccc
acgacgccccctgagccccagacctccacagagtccccgacagaaagcgtttcagagccc
ggggtgacggtgaagcaggaaccacaggaggatggccaggctcaaccgccccccaaagct
ccaaagaccctcagcagtttcttctccccccggaagccagctgtcaaaaaagaagcgaaa
gaagaaggacctggtgctctaagaaaggacgagaccaagggacacctggacccaccaagc
tacaatcctgccaagaacaactaccaccccatcgaggatgcctgctggaaggcgggccag
agggttccttatctggctgtggcccgggcattcgagaagatcgaggaggtctctgctcgg
ctccggatggtggagacgctgagcaacctgctgcgctccgtggtggccctgtcacctgct
gacctcctacccgtcctctacctcagcctcaaccgcctggggccgccccagcaggggctg
gagctcgggatcggagagggcatcctcctcaaggcagtggcccaggccacgggtcggcag
ctggagtccgtccgggccgaggtggccgagaagggtgatgtggggctggtggccgagagc
agccgcagcacccagaggctcgtgctgccccctcctgcgctcaccgccgccggcgtcttc
gccaagttccgggacatcgcgcagctggcgggcagcgcttccaccaccaagaagatggat
gtcatcaaaggcctctttgtggcctgccgtcactcagaggcgcgtttcattgccagagcc
ctgagtggacggctgcgcctcgggctggctgagcagtcggtgctggcggcccttgcccag
gccgtgagcctcacgccccccggtcaagaatgcccccccgccgtggtggacgccgggaag
ggcaagacggcagaagccagaaagacgtggctggaggagcagggcatgatcctgaagcag
accttctgtgaggtacctgacctggaccggatcgtccccgtgctgctggaacacggcctc
gagcggctcccggagcactgcaggctgagcccaggggttcccctgaaaccaatgttggcc
caccccacccggggtgtcagtgaggtcctgaagcgctttgaggaggcagctttcacctgc
gaatacaaatacgacgggcagagggcacagattcacgttctggaaggcggggaggtgaag
atcttcagcaggaatcaggaggacaatactggaaggtaccctgacatcatcagccgcatc
cccaagattaaactcccatcagtcacatccttcatcctagacacagaagctgtagcttgg
gaccgggaaaagaagcagatccagccattccaagtgctcaccacccgcaaacgcaaggag
gtggacgcagcagagatccaggtgcaggtgtgtctgtatgccttcgatctcatctacctc
aacggagagtccctggtacgtgagcccctctcccgacgccggcagctgctccgggagaac
ttcgtagagacggagggcgagttcgtctttgccacctccctggacaccaaggacacggag
cagatcgctgagttcctggagcagtcggtgaaagactcctgcgaggggctgatggtgaag
accctggacgtggatgccacctacgagatcgccaagaggtcacacaattggctcaagctg
aagaaggactacctcgagggtgtgggcgacaccctggacctcgtagtgattggtgcctac
ctgggcaaggggaaacgggccggccggtacggaggcttcctgctggcctcgtacgatgag
gagagcgaggagttccaggccatctgcaagctcggaactggcttcagtgacgaggagctg
gaagagcatcaccagaggctccaggccttagtgctgcccaccccgcgctcctatgtccgg
gctgacggtgcggtggcccctgaccactggctggaccccagcgacgtgtgggaggtgaag
tgcgcggacctctccctgtcccccatctaccctgcggcccggggcctggtggacagcgag
aaggggatctccctccgtttcccccggtttattcgtgtccgtgaggacaagaagccagag
caggccactactagtgcccaggtggccggtctgtacaagaagcagagtcagattcagaac
cagcagggtgctgagccggactccgagcaggaagagttctactag

DBGET integrated database retrieval system