KEGG   Capra hircus (goat): 102174211
Entry
102174211         CDS       T02910                                 

Gene name
CEBPE
Definition
(RefSeq) CCAAT/enhancer binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
chx  Capra hircus (goat)
Pathway
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102174211 (CEBPE)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102174211 (CEBPE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102174211 (CEBPE)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    102174211 (CEBPE)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin ATG16 Myc-LZ GAS UPF0449 Nmad5 SBE2 DUF2605 DUF2514 Fib_alpha
Other DBs
NCBI-GeneID: 102174211
NCBI-ProteinID: XP_005685309
UniProt: A0A452FW47
LinkDB
Position
10
AA seq 281 aa
MSHGTYYECEPRAGQQPLEFSGARAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPADPRPFTYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV
KEEPRGPEGSRGASRSGYNPLQYQVAHCGQTAMHLPPGLASPSQPLRVLKAPLAAAAPPC
SPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcccacgggacctactacgagtgcgagccccgcgctggccagcagccactggagttc
tcaggggcccgcgcggggcctggggagctgggggacatgtgtgagcatgaggcctccatc
gacctgtctgcctacatcgagtctggggaagaacagctcctctccgacctcttcgccgtg
aagccggcccctgaggcccgaggccttaagggccccgggacccctgccttcccccactac
ctgccggctgacccacggcccttcacctatcccccacataccttcggccccgacaggaag
gccttggggcctggcatctacagcagcccagggagctacgaccccagggccgtggccgtg
aaggaggagcctagggggcctgagggcagccggggggccagccgcagcggctacaaccct
ctgcagtaccaagtggcacactgtggacagacagccatgcacctgcccccaggcctggcg
tcacccagccagccattgcgcgtccttaaggcccctttggccgctgccgcgcccccctgc
agcccgctcctcaaggcgccctccccagcgggcccctcacacaagggcaagaaggcggtg
aacaaagacagcctggagtaccggctgcggcgggagcggaacaacatcgcggtgcgcaag
agccgggacaaggccaagcggcgcatcctggagacgcagcagaaggtgctggagtacatg
gccgagaacgagcgcctgcgcagccgcgtggaacagctgacccaggagctggacacgctg
cgcaacctcttccgccagatccctgaggccgccaacctcatcaagggcgtggggggctgc
agctga

DBGET integrated database retrieval system