KEGG   Capra hircus (goat): 102174360Help
Entry
102174360         CDS       T02910                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04068  FoxO signaling pathway
chx04150  mTOR signaling pathway
chx04270  Vascular smooth muscle contraction
chx04510  Focal adhesion
chx04650  Natural killer cell mediated cytotoxicity
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx05034  Alcoholism
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102174360 (BRAF)
   04010 MAPK signaling pathway
    102174360 (BRAF)
   04012 ErbB signaling pathway
    102174360 (BRAF)
   04068 FoxO signaling pathway
    102174360 (BRAF)
   04024 cAMP signaling pathway
    102174360 (BRAF)
   04150 mTOR signaling pathway
    102174360 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102174360 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102174360 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102174360 (BRAF)
   04062 Chemokine signaling pathway
    102174360 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102174360 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102174360 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    102174360 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102174360 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    102174360 (BRAF)
   04720 Long-term potentiation
    102174360 (BRAF)
   04730 Long-term depression
    102174360 (BRAF)
   04722 Neurotrophin signaling pathway
    102174360 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174360 (BRAF)
   05205 Proteoglycans in cancer
    102174360 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102174360 (BRAF)
   05212 Pancreatic cancer
    102174360 (BRAF)
   05225 Hepatocellular carcinoma
    102174360 (BRAF)
   05226 Gastric cancer
    102174360 (BRAF)
   05214 Glioma
    102174360 (BRAF)
   05216 Thyroid cancer
    102174360 (BRAF)
   05221 Acute myeloid leukemia
    102174360 (BRAF)
   05220 Chronic myeloid leukemia
    102174360 (BRAF)
   05218 Melanoma
    102174360 (BRAF)
   05211 Renal cell carcinoma
    102174360 (BRAF)
   05219 Bladder cancer
    102174360 (BRAF)
   05215 Prostate cancer
    102174360 (BRAF)
   05213 Endometrial cancer
    102174360 (BRAF)
   05224 Breast cancer
    102174360 (BRAF)
   05223 Non-small cell lung cancer
    102174360 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    102174360 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102174360 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102174360 (BRAF)
   05160 Hepatitis C
    102174360 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102174360 (BRAF)
   01522 Endocrine resistance
    102174360 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102174360 (BRAF)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102174360 (BRAF)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102174360 (BRAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 102174360
NCBI-ProteinID: XP_017902346
UniProt: A0A452F5E2
LinkDB All DBs
Position
4
AA seq 764 aa AA seqDB search
MAALSGGGGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEA
LLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSS
SSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKK
ALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFF
TLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQE
EASLAETTLPCGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRS
SSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLSNVKALQKSPGPQ
RERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagcggcggtggcggcggcggcggcgcggagcagggccaggctctgttc
aacggggacatggagcccgaggccggcgccgcggcctcttcggctgcggaccccgccatt
cccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggagcatatagaggcc
ctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctatgaa
gaatacaccagcaagctagacgccctccaacaaagagaacaacagttattggaatccctg
gggaatggaactgatttttctgtttctagctctgcatcaacggacaccgttacatcttct
tcctcttctagcctttcagtgctgccttcatctctttcagtttttcaaaatcccacagat
gtgtcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaat
aaacagaggacagtggtacctgcacggtgtggagtcacagtccgggacagcctgaagaag
gcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggg
gagaagaaaccaattggctgggacactgatatttcctggcttactggagaggaattgcat
gtagaagtgttggagaatgttccacttacaacacacaactttgtacggaaaacttttttc
accttagcattttgtgacttctgtagaaagctgcttttccaggggttccgctgtcaaaca
tgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattat
gaccaactagatttgctgtttgtctccaagttctttgaacaccacccaataccacaggag
gaggcctccttagcagagactacccttccatgtggctcatccccttctgcacccccctcc
gattctattgggcccccaattctcaccagtccatctccttcaaaatccattccaattcca
cagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcc
tcatcagctccaaatgtgcatataaacacaatagaacctgtcaatattgatgacttgatt
agagaccaagggtttcgtagtgatggaggatcaaccacaggtttatctgccacaccccct
gcctcattacctggctcactctctaatgtgaaagcattgcagaaatctccaggacctcag
cgagaaaggaagtcctcttcatcctcagaagacaggaatcgaatgaaaacgcttggtaga
cgggattcaagtgacgattgggagattcctgatggacagatcacagtgggacaaagaatt
ggatcagggtcatttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtagga
gtactcaggaaaacacgacatgtgaatatcctcctcttcatgggttattcaacaaagcca
caactggctattgttacccagtggtgtgagggctccagtttatatcatcatctccacatc
attgagaccaaattcgagatgatcaaacttatagatattgcacggcagactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatattttt
cttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatctcga
tggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcaccagaa
gtaatcagaatgcaagataaaaacccatatagctttcagtcagatgtatatgcatttggg
attgttctgtatgaattgatgaccggacagttaccttattcaaatatcaacaacagggac
cagataatttttatggtgggacgaggatatctgtctccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagatgaa
agaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggatttt
agtctatatgcttgtgcttctccaaaaacacccattcaggcagggggatatggagaattt
gcagccttcaagtag

DBGET integrated database retrieval system