KEGG   Capra hircus (goat): 102174516
Entry
102174516         CDS       T02910                                 

Gene name
AZI2
Definition
(RefSeq) 5-azacytidine induced 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102174516 (AZI2)
SSDB
Motif
Pfam: TBD Cnn_1N Chorismate_bind Myb_DNA-bind_3
Other DBs
NCBI-GeneID: 102174516
NCBI-ProteinID: XP_005695563
UniProt: A0A452EY07
LinkDB
Position
22
AA seq 393 aa
MDALVEDDICILNHEKAHRRDPVTPISIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
FLKKRIRILEEKLIGARKDEETSSVGWEQVNKAYHAYREVCIDRDNLKNKLDRMNKDNSE
SLKVLNEQLQSKEVELLQLRTEVETQQVIRNLNPPSSNWEVEKLSCDLKIHGLEQELELM
RKECSDLKIELQKARQTDPSLEDNLNCRDLQRLSVSSDNMQSTYWELKREMSNLHLVTQV
QAELLRKLKTPTAIKKACAPAGCVGDLGKDSTKLHLSTFTAAHRRHAPLSANGRALCHTT
PSPLPGDAKVLSEKAALQSWTDHERSIPHDGTNFQEHNSYSRNSLEDNSWVFPSPPKSSE
TTFGEMKSKPLPLPNLPPLHYLDQHNQNCHYKH
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggatgcactggtggaagatgatatttgtattctgaatcacgaaaaagcccacaggaga
gacccagtgactccaatctcaatatattcaggagatgaatctgttgcctcacattttgcc
ctcgtcactgcatatgaagacattaaaaaaagacttaaggattcagagaaagagaactct
ttcttaaaaaaaagaatcagaattttggaagaaaagcttataggagctcgaaaggatgaa
gaaacaagctctgtgggatgggaacaagtaaataaagcctatcacgcgtaccgagaggtc
tgcattgacagggacaatctgaaaaacaaactggacagaatgaataaagacaactctgaa
tctttgaaagtgttgaatgaacagctacaatctaaagaagtagaactcctccagctgagg
acagaggtggaaactcaacaggtgataagaaatttaaatcctccttcgtcaaactgggag
gtggaaaagttaagctgcgacctgaagatccatggtttggaacaggaactggaactgatg
aggaaagaatgtagcgatctcaaaatagagctgcagaaagccagacaaacggatccatct
ctggaagacaatctgaactgcagagatctgcagagactgagcgtctcaagtgacaatatg
caaagtacatactgggaactgaagagagaaatgtctaacttgcatctggtgactcaagta
caagccgaactactgagaaagctgaaaaccccaactgcaatcaagaaagcttgcgcccca
gcaggatgcgtgggagacctgggtaaagacagcacaaaactgcacttgtcgactttcact
gcagctcacagaagacacgcccccctctcagcaaacggcagagcgctctgccataccacg
ccttcccccttaccaggagacgcaaaggttttatcggagaaggcagctctccagtcgtgg
acagatcacgagcgatccattcctcacgatggcacaaactttcaggaacacaactcttac
agcagaaattccctggaagataattcctgggtattcccaagccctcctaaatcaagtgag
acgacatttggggaaatgaaaagtaaacctttgcctttgcccaacttgccaccactgcat
tacttggatcaacataatcaaaactgccattataaacattaa

DBGET integrated database retrieval system