KEGG   Capra hircus (goat): 102174518
Entry
102174518         CDS       T02910                                 

Gene name
PPARD
Definition
(RefSeq) peroxisome proliferator activated receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
chx  Capra hircus (goat)
Pathway
chx03320  PPAR signaling pathway
chx04310  Wnt signaling pathway
chx05200  Pathways in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102174518 (PPARD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102174518 (PPARD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174518 (PPARD)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102174518 (PPARD)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102174518 (PPARD)
Nuclear receptors [BR:chx03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   102174518 (PPARD)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102174518
NCBI-ProteinID: XP_017894533
UniProt: A0A452EIP4
LinkDB
Position
23
AA seq 441 aa
MEQPPEEAPEARPEEEKEEAASTEGAPELNGGPEHSLPSSSYTDLSQSCSPLSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQHNPQVADLRAFSK
HIYSAYLKNFNMTKKKARGILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNSLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSDLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggagcagcccccagaggaagcccctgaggcccggccagaggaggagaaagaggaagcg
gcaagtacagaaggagccccagagctcaacgggggaccagagcactcacttccttccagc
agctacacagacctctcccagagctgctctccactctcactgctggaccaactgcagatg
ggctgtgacggggcctcatgtggcagcctcaacatggagtgtcgggtgtgcggggacaag
gcgtcgggcttccactacggcgttcacgcgtgtgagggatgcaagggcttcttccgtcgg
acaatccgcatgaagctggagtacgagaaatgtgagcggatctgcaaaatccagaagaag
aaccgcaacaagtgccagtactgccgcttccagaaatgcctggcactgggcatgtcgcac
aatgccatccgtttcggccggatgccagaggctgagaagaggaagctggtggcggggctg
acagccaacgaggggagtcagcacaacccccaggtggccgacctgagggccttctccaag
cacatctacagcgcctacttgaagaacttcaacatgaccaaaaagaaggcccgcggcatc
ctcaccggcaaggccagccacacggcgccctttgtgatccatgacatcgagacgctgtgg
caggcggagaagggcctggtctggaagcagctggtgaacagcctgcccccctacaaggag
atcagcgtgcacgtcttctaccgctgccagtgcaccacggtggagaccgtgcgtgagctc
accgagttcgccaagagcatccccagcttcagcgacctcttcctcaacgaccaggtgacc
ctgctcaagtacggtgtgcatgaggccatcttcgccatgctggcctccattgtcaataag
gacgggctgctggtggccaacggcaccggctttgtcacccgggagttcctgcgcagcctc
cgaaagcccttcagtgacatcattgagcccaagttcgagtttgccgtcaagttcaatgcc
ttggaacttgatgacagtgacctggctctcttcattgcggccatcattctgtgcggagac
cggccaggcctcatgaacgtgtctcaggtggaggccatccaggacaccatcctgcgcgcc
ctcgagttccacctgcaggccaaccaccccgacgcgcagtacctcttccccaagctgctg
cagaagatggccgacctgcggcagctggtcacggagcatgcccagatgatgcagcggatc
aagaagaccgagacggagacctcgctgcaccccctgctccaggagatctacaaggacatg
tactga

DBGET integrated database retrieval system