KEGG   Capra hircus (goat): 102174681
Entry
102174681         CDS       T02910                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04115  p53 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04370  VEGF signaling pathway
chx04919  Thyroid hormone signaling pathway
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05134  Legionellosis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102174681 (CASP9)
   04151 PI3K-Akt signaling pathway
    102174681 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102174681 (CASP9)
   04215 Apoptosis - multiple species
    102174681 (CASP9)
   04115 p53 signaling pathway
    102174681 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102174681 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102174681 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102174681 (CASP9)
   05212 Pancreatic cancer
    102174681 (CASP9)
   05215 Prostate cancer
    102174681 (CASP9)
   05213 Endometrial cancer
    102174681 (CASP9)
   05222 Small cell lung cancer
    102174681 (CASP9)
   05223 Non-small cell lung cancer
    102174681 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102174681 (CASP9)
   05012 Parkinson disease
    102174681 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102174681 (CASP9)
   05016 Huntington disease
    102174681 (CASP9)
   05020 Prion disease
    102174681 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102174681 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102174681 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102174681 (CASP9)
   05152 Tuberculosis
    102174681 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102174681 (CASP9)
   05161 Hepatitis B
    102174681 (CASP9)
   05160 Hepatitis C
    102174681 (CASP9)
   05164 Influenza A
    102174681 (CASP9)
   05162 Measles
    102174681 (CASP9)
   05168 Herpes simplex virus 1 infection
    102174681 (CASP9)
   05163 Human cytomegalovirus infection
    102174681 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102174681 (CASP9)
   05169 Epstein-Barr virus infection
    102174681 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102174681 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102174681 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102174681 (CASP9)
   01002 Peptidases and inhibitors [BR:chx01002]
    102174681 (CASP9)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102174681 (CASP9)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102174681 (CASP9)
Peptidases and inhibitors [BR:chx01002]
 Cysteine peptidases
  Family C14: caspase family
   102174681 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 102174681
NCBI-ProteinID: XP_005690871
UniProt: A0A452E8W3
LinkDB
Position
16
AA seq 452 aa
MDEADRLLLRRYRLPLVGELQVASLWDALLSRELFTPDMIEDIQRAGSGSRRDQARQLIL
DLETRGSQALPLFISCLEDTGQDTLASLLKTSRQAAKQDVEAIRPLDLKPVVLGPEGLKP
EELRVMKQDPSKPSQGKLAPVVLGPEELWPAKLRPEVLRPEVPRPGNIGSGGFTDVCPQD
RAKGNADLAYVLNADPCGHCLIINNVNFCRESGLMTRTGSNIDCERMQRRFHLLQFAVEV
KCDLTAKQMVQALMQLARRDHGALDCCVVVILSHGCQASHRQFPGAVYGTDGCPVSVERI
VNTFNGTGCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDETPNSNPETDATPFQEGP
RSTDEPDAVSSLPTPSDILVSYSTFPGFVSWRDPKSGSWYIETLDSIFEQWAHCEDLQTL
LLRVANAVSVKGIYKQIPGCFNFLRKKLFFKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggctgctcctgcggcggtaccggttgccgctggtcggtgagctg
caggttgcctcgctttgggacgccctgctgagccgcgagctcttcactcccgacatgatc
gaggacattcagagggcaggctcaggatctcggcgcgatcaggccaggcagctgatccta
gatctagagactcgagggagtcaggcccttcctttgttcatctcctgcttggaggacaca
ggccaggacactctggcttcattattgaagaccagcagacaagcagcaaaacaggatgtg
gaggccatcagacccctggatcttaagccggtggtgctcggaccagagggcctcaaacca
gaggagctgagagtgatgaagcaggacccatcaaagccgagccaaggaaaactcgctcca
gtggtgctggggccagaggaactctggccagccaagctcaggcctgaggttctcagacca
gaggtacccaggccagggaacattggttctggaggattcactgatgtctgtcctcaggac
agagccaagggaaatgctgatctggcctatgtcctgaacgcagacccctgcggccactgc
ctgatcatcaacaacgtgaacttctgccgcgagtcggggctcatgacccgcacgggctcc
aacatcgactgtgagaggatgcagcgacgcttccacctgctgcagtttgcggtggaggtg
aaatgtgacctgactgccaagcaaatggtccaggctttgatgcagctggcgcggcgggac
cacggcgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggccagccac
cgccagttcccaggggctgtttatggcacagacggatgtcccgtgtccgttgagagaatt
gtgaacactttcaatggtactggctgccccagcttgggagggaagcccaagctcttcttc
atccaggcctgtggtggagagcagaaagaccatgggtttgaggtggcctccacttcccct
gaagatgagacccccaatagcaaccctgagacggatgctaccccattccaggaaggccca
cgttccactgacgagccagatgccgtgtctagtctgcccacgcccagcgacatcttggtg
tcctactccaccttcccaggctttgtctcctggagggatcccaagagcggctcctggtac
atcgagaccctggacagcatttttgagcagtgggctcactgtgaggaccttcagaccctc
ctcctcagggtcgctaatgctgtttcagtgaaaggaatttacaaacagatccctggctgc
tttaatttcctccggaaaaaacttttctttaaaacataa

DBGET integrated database retrieval system