KEGG   Capra hircus (goat): 102175277
Entry
102175277         CDS       T02910                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04151  PI3K-Akt signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx05162  Measles
chx05165  Human papillomavirus infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05222  Small cell lung cancer
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102175277 (CDKN1B)
   04066 HIF-1 signaling pathway
    102175277 (CDKN1B)
   04068 FoxO signaling pathway
    102175277 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102175277 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102175277 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102175277 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102175277 (CDKN1B)
   05206 MicroRNAs in cancer
    102175277 (CDKN1B)
   05203 Viral carcinogenesis
    102175277 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102175277 (CDKN1B)
   05220 Chronic myeloid leukemia
    102175277 (CDKN1B)
   05215 Prostate cancer
    102175277 (CDKN1B)
   05222 Small cell lung cancer
    102175277 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102175277 (CDKN1B)
   04934 Cushing syndrome
    102175277 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102175277 (CDKN1B)
   05169 Epstein-Barr virus infection
    102175277 (CDKN1B)
   05165 Human papillomavirus infection
    102175277 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102175277 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102175277
NCBI-ProteinID: XP_005680873
UniProt: A0A452EU35
LinkDB
Position
5
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDASGARPAVPLLG
SQANPEDTHLVDQKTDAPDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcttgcagaaacctctttggcccggtcaatcacgaagag
ttaacccgggacttggagaagcattgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaagtacgagtggcaggaggtagaa
aagggcaacctgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggaaggccaggatgccagcggggcccgcccggcggtgcctttacttggg
tctcaggcaaacccagaggacacgcatttggtcgatcagaagactgatgccccggacagc
cagaccgggttagcggagcagtgccctgggataaggaagcgacctgccgcagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttcccccaac
gccggttcagtggagcagacgcccaagaagcctggcctcagaaggcgtcagacgtaa

DBGET integrated database retrieval system