KEGG   Capra hircus (goat): 102175285
Entry
102175285         CDS       T02910                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04218  Cellular senescence
chx04270  Vascular smooth muscle contraction
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04929  GnRH secretion
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102175285 (MAP2K2)
   04012 ErbB signaling pathway
    102175285 (MAP2K2)
   04014 Ras signaling pathway
    102175285 (MAP2K2)
   04015 Rap1 signaling pathway
    102175285 (MAP2K2)
   04370 VEGF signaling pathway
    102175285 (MAP2K2)
   04371 Apelin signaling pathway
    102175285 (MAP2K2)
   04066 HIF-1 signaling pathway
    102175285 (MAP2K2)
   04068 FoxO signaling pathway
    102175285 (MAP2K2)
   04072 Phospholipase D signaling pathway
    102175285 (MAP2K2)
   04071 Sphingolipid signaling pathway
    102175285 (MAP2K2)
   04024 cAMP signaling pathway
    102175285 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    102175285 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    102175285 (MAP2K2)
   04150 mTOR signaling pathway
    102175285 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102175285 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    102175285 (MAP2K2)
   04218 Cellular senescence
    102175285 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102175285 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102175285 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102175285 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102175285 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    102175285 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    102175285 (MAP2K2)
   04660 T cell receptor signaling pathway
    102175285 (MAP2K2)
   04662 B cell receptor signaling pathway
    102175285 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    102175285 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102175285 (MAP2K2)
   04929 GnRH secretion
    102175285 (MAP2K2)
   04912 GnRH signaling pathway
    102175285 (MAP2K2)
   04915 Estrogen signaling pathway
    102175285 (MAP2K2)
   04917 Prolactin signaling pathway
    102175285 (MAP2K2)
   04921 Oxytocin signaling pathway
    102175285 (MAP2K2)
   04926 Relaxin signaling pathway
    102175285 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    102175285 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    102175285 (MAP2K2)
   04916 Melanogenesis
    102175285 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102175285 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    102175285 (MAP2K2)
   04730 Long-term depression
    102175285 (MAP2K2)
   04722 Neurotrophin signaling pathway
    102175285 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102175285 (MAP2K2)
   05206 MicroRNAs in cancer
    102175285 (MAP2K2)
   05205 Proteoglycans in cancer
    102175285 (MAP2K2)
   05230 Central carbon metabolism in cancer
    102175285 (MAP2K2)
   05231 Choline metabolism in cancer
    102175285 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102175285 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102175285 (MAP2K2)
   05225 Hepatocellular carcinoma
    102175285 (MAP2K2)
   05226 Gastric cancer
    102175285 (MAP2K2)
   05214 Glioma
    102175285 (MAP2K2)
   05216 Thyroid cancer
    102175285 (MAP2K2)
   05221 Acute myeloid leukemia
    102175285 (MAP2K2)
   05220 Chronic myeloid leukemia
    102175285 (MAP2K2)
   05218 Melanoma
    102175285 (MAP2K2)
   05211 Renal cell carcinoma
    102175285 (MAP2K2)
   05219 Bladder cancer
    102175285 (MAP2K2)
   05215 Prostate cancer
    102175285 (MAP2K2)
   05213 Endometrial cancer
    102175285 (MAP2K2)
   05224 Breast cancer
    102175285 (MAP2K2)
   05223 Non-small cell lung cancer
    102175285 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102175285 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    102175285 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102175285 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102175285 (MAP2K2)
   05135 Yersinia infection
    102175285 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102175285 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    102175285 (MAP2K2)
   05161 Hepatitis B
    102175285 (MAP2K2)
   05160 Hepatitis C
    102175285 (MAP2K2)
   05164 Influenza A
    102175285 (MAP2K2)
   05163 Human cytomegalovirus infection
    102175285 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102175285 (MAP2K2)
   05165 Human papillomavirus infection
    102175285 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102175285 (MAP2K2)
   01522 Endocrine resistance
    102175285 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102175285 (MAP2K2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102175285 (MAP2K2)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: STE group
  STE7 family
   102175285 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102175285
NCBI-ProteinID: XP_017906345
UniProt: A0A452ENE3
LinkDB
Position
7
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEAHLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPPSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggtccgtcccccaccagcgagggcgcctccgaagcacacctggtggacctccagaagaag
ctggaggagctagagcttgacgagcagcagaagaagcggctggaagccttccttacccag
aaggccaaggttggcgagctcaaggacgatgacttcgaacggatctccgagctgggagcc
ggcaatggtggagtggtcaccaaggtccagcacagaccttcgggcctcatcatggccaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgagagctgcag
gtgctgcatgagtgcaactccccgtacattgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgttgaaa
gaagccaagagaatccccgaagagatcctgggcaaggtcagcatcgcggttctgcggggc
ctggcatacctccgggagaaacaccagatcatgcaccgagacgtgaagccgtccaacatc
ctcgtcaactcccggggggagatcaagctgtgtgactttggggtgagcggccagctcatc
gactccatggccaactccttcgtgggcacgcggtcctacatgtctccggagcgactacaa
ggcacccactactcagtgcagtcagacatctggagcatgggcctgtccctggtggaactg
tccatcggaaggtaccccatccccccgccagacgccaaggagctggaggccatattcggc
cggcccatggttgatggcgcggaaggagaacctcccagcatctcaccacggccgaggccc
cccggacgccccatcagcggtcatgggatggacagccggccggccatggcgatctttgag
ctgctggactacattgtgaacgagcctcctcccaagctgcccaatggcgtgttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagctgagcgagcagacctg
aagatgctcatgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
ggctggttgtgtaaaacactgcggctaaaccagcccagcacgcccacacgcaccgccgtg
tga

KEGG   Capra hircus (goat): 102190520
Entry
102190520         CDS       T02910                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04218  Cellular senescence
chx04270  Vascular smooth muscle contraction
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05034  Alcoholism
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102190520 (MAP2K1)
   04012 ErbB signaling pathway
    102190520 (MAP2K1)
   04014 Ras signaling pathway
    102190520 (MAP2K1)
   04015 Rap1 signaling pathway
    102190520 (MAP2K1)
   04370 VEGF signaling pathway
    102190520 (MAP2K1)
   04371 Apelin signaling pathway
    102190520 (MAP2K1)
   04668 TNF signaling pathway
    102190520 (MAP2K1)
   04066 HIF-1 signaling pathway
    102190520 (MAP2K1)
   04068 FoxO signaling pathway
    102190520 (MAP2K1)
   04072 Phospholipase D signaling pathway
    102190520 (MAP2K1)
   04071 Sphingolipid signaling pathway
    102190520 (MAP2K1)
   04024 cAMP signaling pathway
    102190520 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    102190520 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    102190520 (MAP2K1)
   04150 mTOR signaling pathway
    102190520 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102190520 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102190520 (MAP2K1)
   04210 Apoptosis
    102190520 (MAP2K1)
   04218 Cellular senescence
    102190520 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102190520 (MAP2K1)
   04540 Gap junction
    102190520 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102190520 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102190520 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102190520 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    102190520 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    102190520 (MAP2K1)
   04660 T cell receptor signaling pathway
    102190520 (MAP2K1)
   04662 B cell receptor signaling pathway
    102190520 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    102190520 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    102190520 (MAP2K1)
   04062 Chemokine signaling pathway
    102190520 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102190520 (MAP2K1)
   04929 GnRH secretion
    102190520 (MAP2K1)
   04912 GnRH signaling pathway
    102190520 (MAP2K1)
   04915 Estrogen signaling pathway
    102190520 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    102190520 (MAP2K1)
   04917 Prolactin signaling pathway
    102190520 (MAP2K1)
   04921 Oxytocin signaling pathway
    102190520 (MAP2K1)
   04926 Relaxin signaling pathway
    102190520 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    102190520 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    102190520 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    102190520 (MAP2K1)
   04916 Melanogenesis
    102190520 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102190520 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    102190520 (MAP2K1)
   04726 Serotonergic synapse
    102190520 (MAP2K1)
   04720 Long-term potentiation
    102190520 (MAP2K1)
   04730 Long-term depression
    102190520 (MAP2K1)
   04722 Neurotrophin signaling pathway
    102190520 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102190520 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102190520 (MAP2K1)
   05206 MicroRNAs in cancer
    102190520 (MAP2K1)
   05205 Proteoglycans in cancer
    102190520 (MAP2K1)
   05230 Central carbon metabolism in cancer
    102190520 (MAP2K1)
   05231 Choline metabolism in cancer
    102190520 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102190520 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102190520 (MAP2K1)
   05212 Pancreatic cancer
    102190520 (MAP2K1)
   05225 Hepatocellular carcinoma
    102190520 (MAP2K1)
   05226 Gastric cancer
    102190520 (MAP2K1)
   05214 Glioma
    102190520 (MAP2K1)
   05216 Thyroid cancer
    102190520 (MAP2K1)
   05221 Acute myeloid leukemia
    102190520 (MAP2K1)
   05220 Chronic myeloid leukemia
    102190520 (MAP2K1)
   05218 Melanoma
    102190520 (MAP2K1)
   05211 Renal cell carcinoma
    102190520 (MAP2K1)
   05219 Bladder cancer
    102190520 (MAP2K1)
   05215 Prostate cancer
    102190520 (MAP2K1)
   05213 Endometrial cancer
    102190520 (MAP2K1)
   05224 Breast cancer
    102190520 (MAP2K1)
   05223 Non-small cell lung cancer
    102190520 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102190520 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    102190520 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    102190520 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102190520 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102190520 (MAP2K1)
   05135 Yersinia infection
    102190520 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102190520 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    102190520 (MAP2K1)
   05161 Hepatitis B
    102190520 (MAP2K1)
   05160 Hepatitis C
    102190520 (MAP2K1)
   05164 Influenza A
    102190520 (MAP2K1)
   05163 Human cytomegalovirus infection
    102190520 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102190520 (MAP2K1)
   05165 Human papillomavirus infection
    102190520 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102190520 (MAP2K1)
   01522 Endocrine resistance
    102190520 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102190520 (MAP2K1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102190520 (MAP2K1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: STE group
  STE7 family
   102190520 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 102190520
NCBI-ProteinID: XP_005685187
LinkDB
Position
10
AA seq 391 aa
MCRGAATSSVCRMHSCRAPEMKLERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGE
LKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECN
SPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLRE
KHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSV
QSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGM
DSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIK
RSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgtagaggagcggcaactagttcagtgtgccggatgcatagctgcagggcgccggag
atgaagctggagaggaccaacctggaggccttgcagaagaagctggaggagctggagctc
gatgaacagcagcggaagcgcctcgaggcctttctgacccagaagcagaaggtgggggag
ctgaaggatgatgactttgagaagatcagtgagctgggtgccggcaatggaggtgtggtg
ttcaaggtctcccacaagccgtccggactcgttatggccagaaagctaattcacctggag
atcaaacctgccatccggaaccagatcataagggagctgcaggttctccatgagtgcaac
tcgccgtacatcgtgggcttctacggggccttctacagcgacggcgagatcagcatctgc
atggagcacatggatgggggttccttggatcaagttctgaagaaagctggaagaattcct
gaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctgagggag
aagcacaagattatgcatagagatgtcaagccgtccaacatcctagtgaacagccgtggg
gagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggccaactct
ttcgtgggcaccaggtcctacatgtcgccagagcgactccaggggacccattactccgtg
cagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagatatccc
attcctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggagggagat
gcggcagagaccccgcccaggccaaggacccccgggaggcccctcagctcttatggaatg
gacagccgacctccaatggcaatttttgagttgttggattacatagtcaatgagcctcct
ccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataaatgctta
ataaaaaaccccgcagagagagcagatctgaagcaactcatggttcatgcttttatcaag
agatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggccttaac
cagcccagcacacccacccatgcagctggcgtctaa

DBGET integrated database retrieval system