KEGG   Capra hircus (goat): 102175496
Entry
102175496         CDS       T02910                                 

Gene name
NLRX1
Definition
(RefSeq) NLR family member X1
  KO
K12653  NLR family member X1
Organism
chx  Capra hircus (goat)
Pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx05164  Influenza A
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102175496 (NLRX1)
   04622 RIG-I-like receptor signaling pathway
    102175496 (NLRX1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102175496 (NLRX1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:chx04054]
    102175496 (NLRX1)
Pattern recognition receptors [BR:chx04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102175496 (NLRX1)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 NOD2_WH AAA_22 AAA_16 DUF815 TsaE AAA_25
Other DBs
NCBI-GeneID: 102175496
NCBI-ProteinID: XP_017915161
UniProt: A0A452F1E7
LinkDB
Position
15
AA seq 973 aa
MRWGCHLPRASWSPGLGRVLQPADERVPFLIHWSWPLKGERPLGSPRAFIRHNGSSVGNG
PSCGRHGQLFRGIAASEALQRHRHNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPLAELALERQPPSAGLPPLALSQLFDPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTALKEVLPLMAAAGSRLLFV
LHGLEHLNLNFSLASTGLCSDPEKPEAPAAIITNLLRKYMLPEASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPDCEPGAGGVSVTPAQRDHLVQMLTRNLEGHH
QIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGEMLDSTDPSKLSLM
AYAARTMGKLAYEGVSSRKTYFSEEDVRGCLEAGVQTEEEFQLLRVFRRDALRFFLAPCV
EPGHAGTFVFTVPAMQEYLAALYIVLGLRKTTLQRVGKEVAELVGRVGEDVSLVLGIMAK
LLPLRALPLLFNLLKVVPRVFGRVVGKSREAVAQAMVLEMFREEDYYNDDVLDQIGASIL
GVEGPRRHPDEPPDDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKTLDALENAQAIKKKL
GKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLGSLRQLNLAGVRMTPLKCTVVAAVLGS
GRHDLDEVNLASCQLDPAGLRTLTPVFLRARKLGLQLNSLGPEACRDLRDLLLHDQCQVT
TLRLSNNPLMAAGVALLLEGLAGNTSLKHLSLLHTGLGDEGLELLAAQLDRNQQLQELNV
AYNGAGDTAALALAKAAWKHPSLELLHLYFNELSSECRQALRDLGSTAEGGARVVVSLTE
GTAVSEYWSVILGEVQRNLNSWDRSRVRRHLELLLRDLEDNRGATLNPWRKAQLLRVEGE
VRALLEQLGGPGS
NT seq 2922 nt   +upstreamnt  +downstreamnt
atgaggtggggctgccatttgcccagagcctcttggagccctggtctaggaagagtactc
cagccagcagatgaacgtgtccccttcctgattcactggagttggcctcttaaaggggag
cgccctcttgggtccccgagggcctttatacgccacaacggaagctcagtgggcaatggt
ccttcatgcgggaggcacggacagttgttccggggcattgctgcatctgaagctctccag
cggcaccgccacaatctggccgagtggttcagtcggctgcccagggaagagcgccagttt
ggcccgacctttgcactagacacagtccatgtagaccctgtgatccgtgagagcacccct
gatgagctgctgcgcccactggctgaactggccctggagcgtcagccaccctctgctggg
ctccccccactagccctgtctcagctctttgacccagatgcctgtgggcgccgggtgcag
acggtggtgctttacgggaccgtgggcacaggcaagagcactctggtgcgcaagatggtc
ttggactggtgttatggacggctcccagccttcgagctgctcatccccttctcctgtgag
gacctgtcatccctgggccctgctcctgcctccttgtgccaacttgtagcccagcgctac
actgccctgaaggaggttctgcctctgatggctgctgccggctcccgcctgctgtttgtg
ctccacggcttggagcatctcaacctcaatttctcattagccagcacagggctttgcagt
gaccctgagaagccagaggcaccagctgctatcatcaccaacctgctgcgcaaatacatg
ttgcctgaggccagcattctggtgaccacccggccctctgccatcggccgcatccccagc
aagtacgtgggccgctatggcgagatctgtggcttctccgataccaacctccagaagctc
tacttccagctccgcctcaaccagccagactgcgagcccggagccgggggggtgtcggtc
acgccggctcagcgcgaccacctggtgcagatgctgacccggaacctggaagggcaccat
cagatcgccgctgcctgcttcctgccctcctactgctggctcgtctgtgccaccctgcac
ttcctgcatgctcccacgccagccggccagaccctcacgagcatctacaccagcttcctg
cgtcttaacttcagtggggagatgctggacagcactgacccctccaagttgtccctgatg
gcctatgcggcccgaactatgggcaagctggcctatgagggtgtgtcctcccgcaagacc
tacttctctgaagaggacgtgcgcggctgcctggaagctggcgtccagacagaagaggag
tttcagctgctgcgcgttttccgccgagacgccctgcggttttttctggccccgtgtgtg
gagccaggacacgcgggtaccttcgtgttcaccgtgcccgccatgcaagaatacctggct
gccctctacatcgtgctgggtttgcggaagacgactctacagcgggtgggcaaggaagtg
gccgagctcgtgggccgtgtcggggaggatgtcagcctggtcctgggcatcatggccaag
ctgctgcccttgcgggccctgccgctgctcttcaacctgctcaaggtggttccacgagtg
tttgggcgtgtggtgggtaagagccgcgaggcagtggcccaggccatggtgctggagatg
ttccgagaggaggactactacaatgacgatgtcctggaccagataggtgctagtatcctg
ggcgtcgaaggtccgcggcgccacccagacgagcctccagacgatgaagtctttgagctt
ttccccatgttcatgggcgggcttctgtctgcccacaaccgggcagtgctggctcagctt
ggctgccccatcaagaccctggatgccctggagaatgcccaggccatcaagaagaagctg
ggcaagctgggccggcaggtgctgcccccctcggagctcctggaccacctcttcttccac
tatgagttccagaatcagcgcttctctgccgaggtgcttggctctctgcgccagctcaac
ctggcaggcgtgcgcatgacgcccctcaagtgcacggtggtggcagctgtcctgggcagt
ggaaggcatgacctggatgaggtgaacttggcctcctgccagctggatcctgctgggttg
cgcacgctcacgcctgtcttcctgcgtgcccggaagctggggttgcaactcaacagcctg
ggccccgaggcctgcagggacctccgcgacctgctgctacatgaccagtgccaagtgacc
accctgcggctgtccaacaacccactgatggcggcaggtgtggccctgctgctggagggg
ctggcaggaaatacctccctgaaacacctctctctactgcacacgggccttggggatgag
ggcctggagctgctggctgcccagctggaccgaaaccaacagctccaggagctgaacgtg
gcctacaacggcgctggtgacacggcggccctggccttagccaaggctgcctggaagcac
ccttccttggagctgctgcatctctacttcaacgagctgagctcagagtgccgccaggcc
ctgcgggacttggggagcactgcagagggcggtgcccgggtcgtggtgtcgctgacggag
gggacagcagtgtccgagtactggtcggtgatcctgggtgaagtccagcggaacctcaac
agctgggatcgcagccgggtccggcgccacctggagctgctgctgagggatctggaagac
aaccggggagccacccttaatccctggcgtaaggcccagctgctgcgggtggagggcgag
gtcagggccctcctggagcagctgggcggccctggaagctga

DBGET integrated database retrieval system