KEGG   Capra hircus (goat): 102175660
Entry
102175660         CDS       T02910                                 

Gene name
NFKB1
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
chx  Capra hircus (goat)
Pathway
chx01523  Antifolate resistance
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04064  NF-kappa B signaling pathway
chx04066  HIF-1 signaling pathway
chx04071  Sphingolipid signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04218  Cellular senescence
chx04380  Osteoclast differentiation
chx04613  Neutrophil extracellular trap formation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx04625  C-type lectin receptor signaling pathway
chx04657  IL-17 signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04722  Neurotrophin signaling pathway
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04926  Relaxin signaling pathway
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05030  Cocaine addiction
chx05132  Salmonella infection
chx05133  Pertussis
chx05134  Legionellosis
chx05135  Yersinia infection
chx05140  Leishmaniasis
chx05142  Chagas disease
chx05145  Toxoplasmosis
chx05146  Amoebiasis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05212  Pancreatic cancer
chx05215  Prostate cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102175660 (NFKB1)
   04014 Ras signaling pathway
    102175660 (NFKB1)
   04064 NF-kappa B signaling pathway
    102175660 (NFKB1)
   04668 TNF signaling pathway
    102175660 (NFKB1)
   04066 HIF-1 signaling pathway
    102175660 (NFKB1)
   04071 Sphingolipid signaling pathway
    102175660 (NFKB1)
   04024 cAMP signaling pathway
    102175660 (NFKB1)
   04151 PI3K-Akt signaling pathway
    102175660 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102175660 (NFKB1)
   04218 Cellular senescence
    102175660 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    102175660 (NFKB1)
   04620 Toll-like receptor signaling pathway
    102175660 (NFKB1)
   04621 NOD-like receptor signaling pathway
    102175660 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    102175660 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    102175660 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    102175660 (NFKB1)
   04660 T cell receptor signaling pathway
    102175660 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    102175660 (NFKB1)
   04659 Th17 cell differentiation
    102175660 (NFKB1)
   04657 IL-17 signaling pathway
    102175660 (NFKB1)
   04662 B cell receptor signaling pathway
    102175660 (NFKB1)
   04062 Chemokine signaling pathway
    102175660 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102175660 (NFKB1)
   04917 Prolactin signaling pathway
    102175660 (NFKB1)
   04926 Relaxin signaling pathway
    102175660 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102175660 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102175660 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    102175660 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102175660 (NFKB1)
   05202 Transcriptional misregulation in cancer
    102175660 (NFKB1)
   05206 MicroRNAs in cancer
    102175660 (NFKB1)
   05203 Viral carcinogenesis
    102175660 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102175660 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102175660 (NFKB1)
   05221 Acute myeloid leukemia
    102175660 (NFKB1)
   05220 Chronic myeloid leukemia
    102175660 (NFKB1)
   05215 Prostate cancer
    102175660 (NFKB1)
   05222 Small cell lung cancer
    102175660 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102175660 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102175660 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102175660 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    102175660 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102175660 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102175660 (NFKB1)
   04931 Insulin resistance
    102175660 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102175660 (NFKB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102175660 (NFKB1)
   05135 Yersinia infection
    102175660 (NFKB1)
   05133 Pertussis
    102175660 (NFKB1)
   05134 Legionellosis
    102175660 (NFKB1)
   05152 Tuberculosis
    102175660 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102175660 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    102175660 (NFKB1)
   05161 Hepatitis B
    102175660 (NFKB1)
   05160 Hepatitis C
    102175660 (NFKB1)
   05171 Coronavirus disease - COVID-19
    102175660 (NFKB1)
   05164 Influenza A
    102175660 (NFKB1)
   05162 Measles
    102175660 (NFKB1)
   05168 Herpes simplex virus 1 infection
    102175660 (NFKB1)
   05163 Human cytomegalovirus infection
    102175660 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102175660 (NFKB1)
   05169 Epstein-Barr virus infection
    102175660 (NFKB1)
   05165 Human papillomavirus infection
    102175660 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102175660 (NFKB1)
   05145 Toxoplasmosis
    102175660 (NFKB1)
   05140 Leishmaniasis
    102175660 (NFKB1)
   05142 Chagas disease
    102175660 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102175660 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102175660 (NFKB1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102175660 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 102175660
NCBI-ProteinID: XP_017904753
UniProt: A0A452DXG3
LinkDB
Position
6
AA seq 969 aa
MAEDDPYLGGHEQMFHLDPLNHTMFSPELFQPEMPLPTADGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTDACVRGYNPGLLVHPDLAYLQA
EGGGDRQLTDREKEIIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDF
SPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGAGSTGPGYGFPHYGFPTYGGITFH
PGTTKSNAGMKHGTIDTPSKNDPESCGKSDDREVVNLSEQVTETTERDGASCTGGTAANL
TCSVGVREENCSFQDNLFLEKAMQLAKQHANALFDYAVTGDVKMLLAVQRHLTAVQDENG
DSVLHLAIIHLHNQLVRDLLEVTSGLISDEIINMRNDLYQTPLHLAVITRQEAVVEDLLR
AGADLSLLDRLGNSVLHLAAKEGHDKILGILLKHKKAAQLIDHPNGEGLNAIHVAMMSNS
LPCLLLLMAAGADVNAQERKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPL
HIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWDEDGEDEGVVPGTTPLDMASSWQ
VFDILNGKPYEPEFTPDDLLAQGDMKQLTEDAKLQLYKLLEIPDPDKNWATLAQKLGLGI
LNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALRQMGYTEAIDVIQAAFCTADTSPAKTT
SQAHSLPFAPASTRPQIDELQDDSICDSGVETSFRKLSLAESLTSGTSLLTLNKVPHDYG
QEGPIEGKI
NT seq 2910 nt   +upstreamnt  +downstreamnt
atggcagaagacgacccatatttgggaggacatgaacaaatgtttcatctggatcctctg
aatcacacaatgtttagtccagaattatttcaaccggagatgccactgccaacagcagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgtg
tgtgaaggcccctcccatggaggactccctggtgcgtctagtgaaaagaacaagaagtcc
taccctcaggtcaaaatctgcaactatgtgggacctgcaaaagttattgttcagttggtc
acaaatggaaaaaacatccacctgcatgcacacagcctggtgggaaaacattgtgaggat
ggcgtctgcactgtgacagctgggcccaaggacatggtggtcggctttgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagacgcc
tgtgtaaggggctataatcccgggcttttggtgcatcctgatcttgcctatttgcaggca
gaaggtggaggagaccggcagctcacagatcgggaaaaggaaatcatccgccaggcagct
cttcagcagacgaaggagatggacctcagcgtggtacggctcatgtttacagctttcctt
ccagacagcaccggcagcttcacgaggcgtctggaacccgtggtgtcggacgccatctat
gacagcaaagcccccaatgcatctaacttgaaaatagtaagaatggacaggacagctgga
tgtgtaactggaggggaagagatttatcttctctgtgacaaggttcagaaagatgacatc
cagattcgattttatgaagaggaggaaaatggtggaatttgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
gtcaacattacaaaaccagcctctgtgttcgtgcagcttcggaggaaatctgatttggaa
actagcgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcaa
aggaaacgacagaagctcatgcccaatttctcggacagttttggcggtggtagcggtgct
ggagccggaggcgggggcatgtttggcagcggtggtggaggtgggggtgctggaagtacc
ggcccagggtatggcttcccccactatggattccccacgtatggtggaattaccttccat
cctggaaccactaaatctaatgctgggatgaagcatggaaccatagacaccccatctaaa
aatgaccctgaaagttgtggcaagagtgacgacagagaggttgtaaatctctccgagcaa
gtaacagaaaccacagaacgagatggagcatcctgcacggggggcactgccgctaacctg
acgtgctcggtgggagtaagagaagagaactgcagcttccaggataacctctttctggag
aaggctatgcagctggccaagcagcacgccaatgccctctttgactatgcagtgacggga
gacgtgaagatgctgctggccgtccagcgccatctcactgccgtgcaggatgagaacggg
gacagtgtcttacacttggcaatcatccaccttcataatcagcttgtgagagatctgctg
gaagtcacatctggcttgatttctgatgaaattatcaacatgagaaatgatctctaccag
acacccctgcacttggcagtgatcaccagacaggaagctgtggtggaggacttgctgagg
gcgggcgctgacctgagcctcctggaccgcttgggtaactctgttttgcacctcgctgcc
aaagaaggacatgataaaattctcggtattttactcaagcacaagaaggcagcacaactt
attgaccaccccaacggggaaggtctgaatgccatacatgtagccatgatgagcaacagc
ttgccgtgtctgctgctgctgatggccgcgggggccgacgtcaacgcccaggagcggaag
tcggggcgcacggccctgcacctggccgtggagcatgacaacatctccttggctggctgc
ctgctcctggagggtgatgcccacgtggacagcaccacttatgacggaactacacccctg
cacatagcagccgggagggggtccaccaggctggcggctcttctcaaagcagcaggagca
gatcccctggtggagaacttcgagcctctgtatgacctggatgactcctgggatgaggat
ggagaggatgaaggggtcgtaccgggaaccactcctctggacatggcctccagctggcag
gtatttgacatattaaatgggaaaccctatgagccagagtttacgcctgatgatttgctg
gcacaaggagacatgaaacagctgactgaagatgcaaagctgcagctctacaagctgcta
gaaattcctgatccagacaaaaactgggctactctggcacagaaattaggtctggggata
ctgaacaacgccttccggctgagtcccgctccctccaaaaccctcatggacaactacgag
gtctccgggggcaccataaaggagctgatggaggccctgagacagatgggctacaccgag
gccattgacgtgatccaggcagccttctgcactgcagacaccagcccggccaagaccacc
tcccaagcccactcgctgccattcgcccccgcctccacaaggccacaaatagacgagctc
caggacgacagcatctgtgacagcggtgtggagacctccttccgcaaactcagcctcgcc
gagtctctgaccagcggcacctccttgctaactcttaacaaagtgccccatgactacggg
caggaaggacctatagaaggcaaaatttag

DBGET integrated database retrieval system