KEGG   Capra hircus (goat): 102175798Help
Entry
102175798         CDS       T02910                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
chx  Capra hircus (goat)
Pathway
chx00052  Galactose metabolism
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04142  Lysosome
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102175798 (GAA)
   00500 Starch and sucrose metabolism
    102175798 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102175798 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102175798 (GAA)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102175798 (GAA)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102175798 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102175798
NCBI-ProteinID: XP_005694139
LinkDB All DBs
Position
19
AA seq 937 aa AA seqDB search
MMRWPPCSRTLLGVCTLLSLALLGHILLHDLEVVPRELRGFSQDEIHQACQPGASSPECR
GSPRAAPTQCDLPPNSRFDCAPDKGITQQQCEARGCCYVPAEWPPDAQMGQPWCFFPTSY
PSYRLENLTSTETGYTATLTRAVPTFFPKDIMILKLDVLMETESRLHFTIKDPANRRYEV
PLETPRVSSQAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLP
SHYITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLL
NSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHL
CRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQ
GGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTNP
EALDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLR
AATICASSHQFLSTHYDLHNLYGLTEALASHRALVKARGTRPFVISRSTFAGHGRYSGHW
TGDVWSNWEQLSYSVPETLLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRN
HNALISQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFPE
DPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLT
SVIHSKGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQPMALAVALTASGEAQG
ELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHMSSEGASLQLRNVTVLGVATAPQQ
VLCNSVPVSNFTFNPDTETLAIPVSLTMGEQFVINWS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccctgctcccgcaccctgctgggggtctgcaccctcctctccttg
gccctcctggggcacatcctgcttcatgacttggaggtggtcccccgagaactacgaggc
ttctcccaagatgagattcaccaagcttgccagccaggagccagcagcccagaatgccgt
ggcagccccagggcagcgcccacacagtgcgatctgccccccaacagccgcttcgactgc
gccccagacaagggcatcacccagcagcaatgtgaggcccgcggctgctgctacgtgcct
gcagaatggcctccggatgcccagatggggcagccctggtgcttcttccctaccagctac
cccagttacaggctggagaacctgacctccactgagacagggtacacggccaccctgacc
cgtgccgtcccgaccttcttccccaaggacatcatgatcttgaagctggacgtgttgatg
gagaccgagagcagacttcacttcacgatcaaagatcctgccaacagacgctatgaggtg
cccttggagaccccgcgtgtcagcagccaggcaccgttcacactctacagcgtggagttc
tcagaggagccctttggggtggtcgtgcggcggaagctggacggacgggtgctgctgaac
actacggtggcccccctgttctttgcggaccaatttctgcagctgtccacctccctgcca
tcccactacatcacaggccttgccgaacaccttgggtccctgatgctcagcaccaactgg
accaagatcaccctctggaaccgggacatcgcccctgagcccaacgtgaacctgtacgga
tctcaccctttctacctggtccttgaggatggcgggttggctcatggggtcttcctgctg
aacagcaatgccatggatgtggtcctgcagcccagcccagccctcagctggagatcgaca
ggcgggatcctggacgtgtacatcttcctgggcccggagcccaagagcgtggtgcagcag
tacctggatgttgtgggctacccgttcatgccgccgtactggggcctgggcttccacctg
tgccgctggggctactccacctccgccatcacccgccaggtcgtggagaacatgaccagg
gcctacttccccctggacgtccagtggaatgacctcgactacatggatgccagacgggac
ttcactttcaacaaggaccacttcggggacttcccggccatggtgcaggagctccaccag
ggtggtcggcggtacatcatgatcgtggatcctgccatcagcagctcaggccctgctggg
acctaccgaccctacgacgagggtctgaggcggggagtcttcatcaccaatgagactggg
cagccactgattggacaggtgtggcccggactcaccgccttccccgacttcaccaacccc
gaagctcttgactggtggcaggacatggtgaccgagttccacgcccaagtgcctttcgat
ggcatgtggatcgatatgaacgagccatccaatttcgtgaggggctcagtggatggctgc
ccagacaacagcctggagaacccaccctacctcccaggggtggttggtgggaccctccgg
gcagccaccatctgcgcctccagccaccagttcctgtccacgcactacgacctgcacaac
ctgtatggcctgactgaagccttagcctcccacagggccctggtgaaggctcgagggacg
cgtcccttcgtgatctctcgctcaacctttgccggccacggccgatactctggccactgg
acaggggatgtgtggagcaactgggagcagctttcctactctgtgccagaaaccctgctt
ttcaatctgctgggggtgcccctggtgggggctgacatctgtggcttcctgggcaacacc
tcagaggagctgtgtgtgcgttggacccagctgggggccttctaccccttcatgcggaac
cacaatgccctgatcagccagccgcaggaaccatacaggttcagcgagacggcgcagcaa
gccatgaggaaggccttcaccctgcgctacgtgctgctgccctatctctacacgctgttc
cacggggctcacgtcagaggcgagacggtggcccggcccctcttcctggagttccctgag
gaccccagcacctggactgtggaccgccagctcctgtggggggaagctctgctcatcacc
ccagtgctcgaggctgagaaggttgaagtcactggctacttcccccagggcacatggtac
gacctgcagacggtaccaatggaagcctttggcagcctcccgcctcctgcacccctcacg
tctgtcatccacagcaaggggcagtgggtgacgctgtctgccccgctggacaccatcaac
gtccacctccgggccgggcacatcatccctatgcagggccctgccctcacgaccaccgag
tcccgcaagcagcccatggccctggctgtggccctgacagccagtggggaggcccaaggg
gagctgttctgggacgacggggagagcctgggagtgctggatggtggggactacacgcag
ctcatcttcctggccaagaataacacctttgtaaacaagctggtgcacatgagcagtgag
ggggccagcctgcagctgaggaacgtgactgtcctgggggtggccacagccccgcagcag
gtcctctgcaacagcgttcctgtctccaacttcaccttcaaccctgacacggagactctg
gccatccctgtctcgctgaccatgggagagcagtttgtcatcaattggtcttaa

DBGET integrated database retrieval system