KEGG   Capra hircus (goat): 102176051
Entry
102176051         CDS       T02910                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
chx  Capra hircus (goat)
Pathway
chx04110  Cell cycle
chx04152  AMPK signaling pathway
chx04218  Cellular senescence
chx04914  Progesterone-mediated oocyte maturation
chx05161  Hepatitis B
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102176051 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102176051 (CCNA1)
   04218 Cellular senescence
    102176051 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102176051 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102176051 (CCNA1)
   05202 Transcriptional misregulation in cancer
    102176051 (CCNA1)
   05203 Viral carcinogenesis
    102176051 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102176051 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102176051 (CCNA1)
   05161 Hepatitis B
    102176051 (CCNA1)
   05169 Epstein-Barr virus infection
    102176051 (CCNA1)
   05165 Human papillomavirus infection
    102176051 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:chx03032]
    102176051 (CCNA1)
   03036 Chromosome and associated proteins [BR:chx03036]
    102176051 (CCNA1)
DNA replication proteins [BR:chx03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102176051 (CCNA1)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102176051 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 102176051
NCBI-ProteinID: XP_017912148
LinkDB
Position
12
AA seq 405 aa
MHLSSSKSGVVLAPVSRGPEACQMITRGQFGQDPLQRTVLGVLTENGQYRRTCGQGLTTL
RCFSGSENAFPPAGKKALSDSRVQAPAKQGFDIYMDEPEQGDRDSCPGRKGMALEDAYEV
DTSALKSDLHFLLDFNTVSPMLVDSSLHSQSEDASDFGTDVINVTEYAEEIHHYLREAEI
RHRPKAHYMRKQPDITESMRTILVDWLAEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLATFTGYSLSEIVPCLSELHKTCLSIPHRPQQAIREKYKASK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcatctcagcagctccaagagtggagtagtgctggctccagtgtcccgaggtcctgag
gcctgtcagatgataaccagaggccagttcggccaggatccgctacaaagaacagtacta
ggagtgctaactgagaatgggcagtacaggaggacctgtggccaggggctcaccacactc
aggtgtttctctggatcagaaaatgccttccctccagctggaaagaaagcgctgtcggac
agtagagttcaggcacctgccaagcaaggatttgacatctacatggatgagcctgaacag
ggggacagagatagctgcccagggcgaaaggggatggcattagaggatgcgtatgaagta
gacaccagcgcactcaagtcagaccttcacttcctgttggattttaacacagtttcccct
atgctggtagattcatctctccactcccagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcattaccttagagaagccgaaata
agacacaggcccaaggcacactacatgaggaaacaaccagacatcacagaaagcatgcgg
accattctggtggattggctggctgaggtcggagaggagtacaagctccgcgcagagacc
ctctacctcgctgtcaacttcctggacaggtttctttcctgcatgtctgttcttagaggg
aaattacagcttgtaggaacagcagctattctccttgcttcgaaatatgaagaaatatat
ccacccgaagtagatgagtttgtctacataaccgatgacacctacacaaaacgacaactg
ctgagaatggaacacttgctcctgaaggtcctggcttttgatctgacagtgccaactacc
aaccagttcctccttcagtacttaaggaggcaaggagtgtgcatcaggactgagaacctg
gccaagtacgtagcagaactgagtctccttgaagctgacccgttcttgaaataccttcct
tcactgatagctgcagccgcttattgcctggcaaactatactgtgaacaggcacttctgg
ccagaaaccctcgccacatttacaggctattcattaagtgaaatcgtgccttgcctgagt
gagctacataaaacatgcctcagtataccccatcgacctcagcaagcaatcagggagaag
tacaaggcttcaaagtaa

KEGG   Capra hircus (goat): 102190390
Entry
102190390         CDS       T02910                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
chx  Capra hircus (goat)
Pathway
chx04110  Cell cycle
chx04152  AMPK signaling pathway
chx04218  Cellular senescence
chx04914  Progesterone-mediated oocyte maturation
chx05161  Hepatitis B
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05203  Viral carcinogenesis
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102190390 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102190390 (CCNA2)
   04218 Cellular senescence
    102190390 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102190390 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102190390 (CCNA2)
   05202 Transcriptional misregulation in cancer
    102190390 (CCNA2)
   05203 Viral carcinogenesis
    102190390 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102190390 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102190390 (CCNA2)
   05161 Hepatitis B
    102190390 (CCNA2)
   05169 Epstein-Barr virus infection
    102190390 (CCNA2)
   05165 Human papillomavirus infection
    102190390 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:chx03032]
    102190390 (CCNA2)
   03036 Chromosome and associated proteins [BR:chx03036]
    102190390 (CCNA2)
DNA replication proteins [BR:chx03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102190390 (CCNA2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102190390 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102190390
NCBI-ProteinID: XP_017904652
UniProt: A0A452F227
LinkDB
Position
6
AA seq 430 aa
MLGSSAHGPAAREAGSALTLQQSAFQEDQENVNPEKSAPAQQPRTRAGLAVLRAGNSRGA
APQRPKTRRVAPLKDLPINDEHVTVPPWKANSKQPAFTIHVDEAEKEIQKRPTESKKSES
EDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDI
HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRF
LSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVL
AFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHL
ALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVS
LLNPPETLNV
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcacgggcctgcggcccgcgaggcgggttcggcgctaacattg
cagcagtcggcgttccaggaggaccaggagaacgtcaaccccgagaagtcggcgcccgcc
cagcagccccggacccgggctgggctggcggtactgagggccgggaactcgcggggtgca
gcgccccagaggcctaagacgcgacgggttgcacctcttaaggatcttcctataaatgat
gagcatgtcactgttcctccctggaaagcaaacagtaaacagcctgcatttaccattcat
gtggatgaagcagaaaaagagattcaaaagaggccaactgaatctaaaaaatcagaaagt
gaagatgtcttggcttttaattcagctgttactttaccaggaccaagaaagccactggca
cctcttgattacccaatggatggtagttttgagtctccacatactatggaaatgtcagtt
gtactggaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgaggacatt
cacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatgaagaaa
cagccagacattaccaacagtatgagggctatcctcgtagactggttagttgaagtagga
gaagaatataaactgcagaacgagaccctgcatttggctgtgaactacattgataggttt
ctttcatccatgtctgtgttgagaggaaaacttcaacttgtgggcactgctgctatgctt
ttagcctcaaagtttgaagaaatatacccaccagaagtagcagagtttgtatacattaca
gatgatacatataccaagaaacaagttctgaggatggagcacctagtcttgaaagtcttg
gcttttgacttagctgcaccaacaataaatcagtttcttacccagtacttcctgcatcag
cagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagagttaagtttgata
gatgctgacccatatctaaagtatttgccatcagttatcgctgcagcggcctttcattta
gcactctacacagtcacaggacaaagctggcctgaatcattagtacagaagactggatat
actctggaaactctaaagccttgtctcctggaccttcaccagacctacctcagagcacca
cagcacgcacaacagtcaataagagagaagtacaaaaattccaagtatcacggtgtttct
ctcctcaacccaccagagacactaaatgtgtaa

DBGET integrated database retrieval system