KEGG   Capra hircus (goat): 102176106
Entry
102176106         CDS       T02910                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04071  Sphingolipid signaling pathway
chx04115  p53 signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx04217  Necroptosis
chx04650  Natural killer cell mediated cytotoxicity
chx04932  Non-alcoholic fatty liver disease
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05022  Pathways of neurodegeneration - multiple diseases
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102176106 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102176106 (BID)
   04215 Apoptosis - multiple species
    102176106 (BID)
   04217 Necroptosis
    102176106 (BID)
   04115 p53 signaling pathway
    102176106 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102176106 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102176106 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102176106 (BID)
   05014 Amyotrophic lateral sclerosis
    102176106 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    102176106 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102176106 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102176106 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102176106 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102176106 (BID)
   05161 Hepatitis B
    102176106 (BID)
   05160 Hepatitis C
    102176106 (BID)
   05164 Influenza A
    102176106 (BID)
   05162 Measles
    102176106 (BID)
   05168 Herpes simplex virus 1 infection
    102176106 (BID)
   05163 Human cytomegalovirus infection
    102176106 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102176106 (BID)
   05169 Epstein-Barr virus infection
    102176106 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102176106 (BID)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 102176106
NCBI-ProteinID: XP_017904202
LinkDB
Position
5
AA seq 191 aa
MDLKVSNGPGLGDERTTSLLLLGFLQSCPNSCFQRELEALGHEFSGHLFHDDELQTDGNR
SSYFSVAAETDSERQEEAVREVARQLAQIGDRLEGSIRPGMVASLASRFSVRSLSEEDRR
QCLADALEQLMRTCPADVDHEKTQLLLTMLLAKKIADHSPALLRDVFRTTVTFINQNLLA
SVRNLVRSEMD
NT seq 576 nt   +upstreamnt  +downstreamnt
atggatttgaaggttagcaatggccctggcctcggggacgagcgcaccacaagcctgctg
ctgcttggcttcctgcagagctgccccaactcctgcttccagagggagctggaggcgctg
ggccacgagttttctgggcacctgttccatgacgacgagctgcagacggacggcaaccgc
agcagctacttctccgtggcagcggagacagattctgagcgtcaggaggaggcagtccgc
gaagtcgcccggcagctcgcccagattggggacaggctggagggcagcatccgcccaggg
atggtggccagcctggcctcacgcttcagtgtcaggagcctgtcggaggaggacaggagg
cagtgcctggcggacgcgctggaacagctcatgcgaacctgccctgcggacgtggaccac
gagaagacccagctcctgctcactatgcttttggccaaaaagatagccgaccactcgcca
gccttgctccgagacgtcttccgcacaacggtgaccttcatcaaccagaacctcctcgcc
tctgtgaggaacttagtccgaagtgagatggactga

DBGET integrated database retrieval system