KEGG   Capra hircus (goat): 102176291Help
Entry
102176291         CDS       T02910                                 

Gene name
NCF1
Definition
(RefSeq) neutrophil cytosolic factor 1
  KO
K08011  neutrophil cytosolic factor 1
Organism
chx  Capra hircus (goat)
Pathway
chx04062  Chemokine signaling pathway
chx04145  Phagosome
chx04380  Osteoclast differentiation
chx04666  Fc gamma R-mediated phagocytosis
chx04670  Leukocyte transendothelial migration
chx05140  Leishmaniasis
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102176291 (NCF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102176291 (NCF1)
   04670 Leukocyte transendothelial migration
    102176291 (NCF1)
   04062 Chemokine signaling pathway
    102176291 (NCF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102176291 (NCF1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102176291 (NCF1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102176291 (NCF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102176291 (NCF1)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    102176291 (NCF1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    102176291 (NCF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_1 NECFESHC SH3_9 p47_phox_C SH3_2 PX hSH3 SH3_3
Motif
Other DBs
NCBI-GeneID: 102176291
NCBI-ProteinID: XP_017896239
UniProt: A0A452FLN5
LinkDB All DBs
Position
25
AA seq 392 aa AA seqDB search
MGDHFIRHIALLGFEKRFVPSQHYVYMFLVKWHDLSEKVVYRRFTEIYEFHKILKEMFPI
EAGDINPENRIIPHLPAPRWFDGQRVAESRQGTLTEYCSALMSLPVKISRCPHLLNFFKV
RPDDLKLPTDSQVKKPETYLMPKDGKSNAADITGPIILQTYRAIADYEKGSSSQMALATG
DVVDVVEKNESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPEPNYAGEPYVTIKAYTAV
LEDEMSLQEGETIEVIHKLLDGWWVIRKEDVTGYFPSMYLQKAGQDVAQAQSQIKSRGAP
PRRSSIRNAHSIHQRSRKRLSQDTYRRNSVRFMQQRRHQRLGPRSSRSALKEQQQPKTER
PKPQPAVPPRPSADLILHRCSESTKRKLASAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccacttcatccgccacattgccctcctgggcttcgagaagcgcttcgtcccc
agccagcactacgtctatatgtttctggtgaaatggcacgacctgtctgagaaggtggtc
tatcggcgcttcaccgagatctacgaattccacaaaatcttaaaggagatgtttcctatt
gaggcgggggacatcaacccagagaacaggatcatcccgcacctgccagccccgcggtgg
tttgatgggcagcgggtggccgagagccgccagggcactcttaccgagtactgcagcgcg
ctcatgagcctgcctgtcaagatctcccgctgcccgcacctcctcaacttcttcaaggtg
cgccccgacgacctcaagctccccacagacagccaggtgaaaaagccagagacatacctg
atgcccaaagacggcaagagcaacgctgcggacatcacgggccccatcatcctgcagacg
taccgcgccatcgctgactacgagaagggctcgagctcgcagatggcgctggccacgggt
gacgtggtggacgtcgtggagaagaacgagagcggttggtggttctgccaaatgaagaca
aagcgtggctgggtcccagcgtcctacttggagcctctggacagtcctgatgaagccgag
gacccagaacccaactatgcaggtgagccctacgtcaccatcaaagcctacactgctgta
ctggaggacgagatgtccttgcaggagggtgaaaccattgaggtcattcacaagctcctg
gatggctggtgggtcatcaggaaagaagatgtcacaggttactttccatccatgtacctg
cagaaggcagggcaggacgtagcccaggcccaaagccagatcaagagccggggggcgccg
ccccgcaggtcgtccatccgcaacgctcacagcatccaccagcggtcacggaagcgcctc
agccaggacacctatcggcgcaacagcgtccgttttatgcagcagcgccgccaccagcgg
ctcgggcctcggagctcgcggagcgccctgaaggagcagcagcaacccaagaccgagcgc
cccaagccgcagccggccgtcccccccaggcccagcgcagacctcatcctgcaccgctgc
agcgagagtaccaagcggaagctggcctccgccgtctga

DBGET integrated database retrieval system