KEGG   Capra hircus (goat): 102176415
Entry
102176415         CDS       T02910                                 

Gene name
STAT5B, STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
chx  Capra hircus (goat)
Pathway
chx04012  ErbB signaling pathway
chx04062  Chemokine signaling pathway
chx04217  Necroptosis
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04917  Prolactin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102176415 (STAT5B)
   04630 JAK-STAT signaling pathway
    102176415 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102176415 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102176415 (STAT5B)
   04659 Th17 cell differentiation
    102176415 (STAT5B)
   04062 Chemokine signaling pathway
    102176415 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102176415 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    102176415 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102176415 (STAT5B)
   05203 Viral carcinogenesis
    102176415 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102176415 (STAT5B)
   05220 Chronic myeloid leukemia
    102176415 (STAT5B)
   05223 Non-small cell lung cancer
    102176415 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102176415 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102176415 (STAT5B)
   05161 Hepatitis B
    102176415 (STAT5B)
   05162 Measles
    102176415 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102176415 (STAT5B)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102176415 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102176415
NCBI-ProteinID: XP_017920604
UniProt: A0A452FKJ9
LinkDB
Position
19
AA seq 787 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REATNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SNSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQPHYNMYPQNPDPVLDNDGDFDLDDTIDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggagatgcccttcatcagatgcaagca
ctgtatggtcagcatttccccattgaggtgcgccattacttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtgggggaagacggg
ttcctactgaagatcaagctggggcactacgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtgcgctgcattcgccacattctgtacaatgagcagaggctggtc
cgagaagccaccaatggtacttctccggctggaagtctcgctgatgccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacagccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggcggggaacggaggcccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgttggctgaggtcaacgccaccatc
acagacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaacccgccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgattacagcggggagatcctgaacaactgc
tgtgtgatggagtaccaccaggccacaggcacgctcagtgcccacttcaggaacatgtcc
ctgaaacgaattaagagatctgaccgacgtggagcggaatcggtgacagaagaaaaattc
accatcctgtttgaatcacagttcagtgttggtggaaacgagctggtgtttcaagtcaag
accctgtctctcccagtggtggtgattgttcacggcagccaggataacaatgcgacggcc
actgttctctgggacaacgcttttgcagagcctggcagggtgccgtttgcagtgcccgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggctgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcaacagccacctcgaggactacaacggcatgtccgtgtcctggtcccagttcaaccgg
gagaatttacccggacggaattacactttctggcagtggtttgacggtgttatggaagtg
ctaaagaaacatctcaagcctcattggaatgacggggctatcttgggtttcgtgaacaag
caacaggcccacgacctgcttatcaacaagccagacgggaccttcctgctgaggttcagt
gactctgaaatcggtggcatcaccattgcctggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagatttctccatccggtccctggctgaccgcctg
ggagatctgagttaccttatctacgtgtttcctgaccggcccaaagatgaagtgtactcc
aagtattacaccccagttccatgcgagcctgccactgctaaagcagtggatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgagcgcctctgcagactctgccgga
ggcagcgccacgtacatggaccaggctccctccccagccgtgtgcccccagcctcactat
aacatgtacccgcagaaccccgaccccgtccttgacaacgatggtgacttcgatctggac
gacacgatcgacgtggcgcggcgtgtggaggagctcctaggccgacccatggacagtcag
tggatcccccacgcacagtcgtga

KEGG   Capra hircus (goat): 102185866
Entry
102185866         CDS       T02910                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
chx  Capra hircus (goat)
Pathway
chx04012  ErbB signaling pathway
chx04217  Necroptosis
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04917  Prolactin signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05161  Hepatitis B
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102185866 (STAT5A)
   04630 JAK-STAT signaling pathway
    102185866 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102185866 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102185866 (STAT5A)
   04659 Th17 cell differentiation
    102185866 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102185866 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    102185866 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102185866 (STAT5A)
   05203 Viral carcinogenesis
    102185866 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102185866 (STAT5A)
   05220 Chronic myeloid leukemia
    102185866 (STAT5A)
   05223 Non-small cell lung cancer
    102185866 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102185866 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102185866 (STAT5A)
   05161 Hepatitis B
    102185866 (STAT5A)
   05162 Measles
    102185866 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102185866 (STAT5A)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102185866 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102185866
NCBI-ProteinID: XP_017920601
LinkDB
Position
19
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REATNGNSSAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLLFLAQKLFNN
SSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVSASADSAGSSATY
MDQAPSPAVCPQPHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDPSLP
PPTGLFTPARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgccctgcgccagatgcaggtg
ctatacgggcagcacttccccatcgaggtccggcattacttggcgcagtggattgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgggcccaggccacccagctc
ctggagggcctggtgcaggagttgcagaagaaggcagagcaccaagtcggggaagacggg
ttcctactgaagatcaagctggggcactacgccacgcagctccagaacacgtacgaccgc
tgccccatggagctggtgcgctgcattcgccacattctgtacaatgagcagaggctggtc
cgagaagccaccaatggtaattcttctgctgggatcctggttgatgccatgtcccagaaa
caccttcagatcaaccagacatttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcaacagactcaagagtatttcatcatccagtatcaggagagcctg
aggatccaggctcagtttgcccagctggcccagctgaacccccaggagcgactgagccgg
gagacagccctccagcagaagcaggtgtccctggaggcctggctgcagcgcgaggcccag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgatgagctgatccagtggaagcggcggcagcag
ctggcggggaacggaggcccccccgagggcagcctggatgtgctacagtcctggtgtgag
aagttggcggagatcatctggcagaaccggcagcagatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcatcgagaagcagccccctcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgtctgctggtgggcgggaagctg
aacgtgcacatgaacccgccccaggtgaaggccaccatcatcagcgagcagcaggccaag
tcactgctcaagaacgagaacacccgcaatgagtgcagcggggagatcctgaacaattgc
tgtgtgatggagtatcaccaggccacaggcaccctcagcgcccacttcaggaacatgtcc
ctcaagaggatcaagcgagctgaccggcgaggcgcagagtctgtgacggaagagaagttc
acggtcctgtttgagtctcaattcagtgttggcagcaatgagcttgtgttccaggtgaag
accctgtcccttcctgtggttgtcatcgttcacggcagccaggaccacaatgctaccgcc
accgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgcggtgcctgac
aaagtcctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctgttgtttctggcgcagaagctgttcaacaac
agcagcagccacctcgaggactacaacggcatgtctgtgtcctggtcccagttcaatcgg
gagaacttgcccggctggaactacaccttctggcagtggttcgacggggtcatggaggtg
ctgaagaaacatcacaagccccactggaatgacggggccatcctaggttttgtgaacaag
caacaggcccatgacctgctcatcaacaagcccgacggtaccttcttgttgcgctttagc
gactcagaaattgggggcatcaccattgcctggaagtttgactctcctgaccgtaacctg
tggaatctgaagccattcaccacgcgggatttctccatccgatccctggccgaccggttg
ggggacctgaactatctcatctacgtgtttcccgaccggcccaaggatgaggtcttctcc
aagtactacactcctgtgcttgctaaagcagtggacggatacgtgaagccgcagatcaag
caagtggtccctgagtttgtgagcgcctctgcagactctgctggaagcagcgccacctac
atggaccaggctccctccccagccgtgtgcccccagcctcactataacatgtacccacag
aaccctgacccagtgctcgaccaggatggagaattcgacctggacgagaccatggatgtg
gcccggcacgtggaagaactcctccgccgcccaatggacagtctggacccctctctcccc
ccgcccactggtctctttactcctgccagaggctcgctctcctga

KEGG   Capra hircus (goat): 102186154
Entry
102186154         CDS       T02910                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04217  Necroptosis
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04630  JAK-STAT signaling pathway
chx04659  Th17 cell differentiation
chx04917  Prolactin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04931  Insulin resistance
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05145  Toxoplasmosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05163  Human cytomegalovirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05212  Pancreatic cancer
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102186154 (STAT3)
   04066 HIF-1 signaling pathway
    102186154 (STAT3)
   04068 FoxO signaling pathway
    102186154 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102186154 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102186154 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102186154 (STAT3)
   04062 Chemokine signaling pathway
    102186154 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102186154 (STAT3)
   04917 Prolactin signaling pathway
    102186154 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102186154 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102186154 (STAT3)
   05206 MicroRNAs in cancer
    102186154 (STAT3)
   05205 Proteoglycans in cancer
    102186154 (STAT3)
   05203 Viral carcinogenesis
    102186154 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102186154 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102186154 (STAT3)
   05221 Acute myeloid leukemia
    102186154 (STAT3)
   05223 Non-small cell lung cancer
    102186154 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102186154 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102186154 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102186154 (STAT3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102186154 (STAT3)
   05160 Hepatitis C
    102186154 (STAT3)
   05171 Coronavirus disease - COVID-19
    102186154 (STAT3)
   05162 Measles
    102186154 (STAT3)
   05163 Human cytomegalovirus infection
    102186154 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102186154 (STAT3)
   05169 Epstein-Barr virus infection
    102186154 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102186154 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102186154 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102186154 (STAT3)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102186154 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 E2R135 DUF4795 Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 102186154
NCBI-ProteinID: NP_001301207
UniProt: A0A0G3VSP3
LinkDB
Position
19
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLR
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRSLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggatcgagagt
caagattgggcatatgcggccagcaaagaatcacatgcaactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcaattccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtgacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcagg
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctggaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagcaatggagtatgtgcagaaaactctcacggatgaagaattg
gcagactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatcccagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtggtggagcggcagccctgcatgcctatgcatcctgaccggtcattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaaaattaaagtgtgcattgacaaagactccggggatgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagtctctcagcggagttcaagcacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgacgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagatcgacctggagacgcactcattgcca
gtggtggtgatctccaacatctgtcagatgcccaacgcctgggcatccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaagctcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaaaggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggcaccttcctgttgagattcagtgaaagcagcaaagaaggaggagtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccgctggtctatctctaccctgacattccaaaggag
gaggcattcggaaagtactgtcggccggagagccaggagcatcccgaagctgacccaggt
agtgctgccccatacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctgaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system