KEGG   Capra hircus (goat): 102176770
Entry
102176770         CDS       T02910                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04720  Long-term potentiation
chx04724  Glutamatergic synapse
chx04728  Dopaminergic synapse
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102176770 (PPP3CA)
   04310 Wnt signaling pathway
    102176770 (PPP3CA)
   04370 VEGF signaling pathway
    102176770 (PPP3CA)
   04020 Calcium signaling pathway
    102176770 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    102176770 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102176770 (PPP3CA)
   04218 Cellular senescence
    102176770 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102176770 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    102176770 (PPP3CA)
   04660 T cell receptor signaling pathway
    102176770 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    102176770 (PPP3CA)
   04659 Th17 cell differentiation
    102176770 (PPP3CA)
   04662 B cell receptor signaling pathway
    102176770 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102176770 (PPP3CA)
   04921 Oxytocin signaling pathway
    102176770 (PPP3CA)
   04924 Renin secretion
    102176770 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102176770 (PPP3CA)
   04728 Dopaminergic synapse
    102176770 (PPP3CA)
   04720 Long-term potentiation
    102176770 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102176770 (PPP3CA)
   04380 Osteoclast differentiation
    102176770 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102176770 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102176770 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    102176770 (PPP3CA)
   05020 Prion disease
    102176770 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    102176770 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102176770 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102176770 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102176770 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    102176770 (PPP3CA)
   05163 Human cytomegalovirus infection
    102176770 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102176770 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102176770 (PPP3CA)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102176770 (PPP3CA)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102176770 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 102176770
NCBI-ProteinID: XP_017904759
UniProt: A0A452G8C4
LinkDB
Position
6
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacggcaaaagaagtgtttgataacgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggagggcaggctcgaagagactgtc
gcattgagaataataacagagggggcttcaattcttcgacaggaaaaaaacttgctggat
attgatgctccagtcacagtttgtggggacatccatggacaattctttgacttgatgaaa
ctctttgaagtggggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggctttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgtgtatatgatgcctgcatggat
gcctttgactgcctgcccctggctgccctgatgaaccagcagttcctgtgtgtacacggc
ggtttgtctccagagataaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacctatgtgtgatatcctgtggtcagacccgctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcaggggctgttcatacttctac
agttacccggctgtatgtgaattcttgcagcacaataacttgttatctatcctccgagct
cacgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctcattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgttttcacctggtccctgccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagacgatgaactggggtcagaa
gaagatggatttgatggagcaacggctgcggccaggaaggaggtgataagaaataagatc
cgagccatcggcaagatggccagagtgttctcggttctcagagaagagagtgaaagtgtg
ctgacgctgaaaggcctgacgcccacaggcatgctccccagcggcgtgctttctggaggg
aaacaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccgcctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Capra hircus (goat): 102177339
Entry
102177339         CDS       T02910                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04720  Long-term potentiation
chx04724  Glutamatergic synapse
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102177339 (PPP3R2)
   04310 Wnt signaling pathway
    102177339 (PPP3R2)
   04370 VEGF signaling pathway
    102177339 (PPP3R2)
   04020 Calcium signaling pathway
    102177339 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    102177339 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102177339 (PPP3R2)
   04218 Cellular senescence
    102177339 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102177339 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    102177339 (PPP3R2)
   04660 T cell receptor signaling pathway
    102177339 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    102177339 (PPP3R2)
   04659 Th17 cell differentiation
    102177339 (PPP3R2)
   04662 B cell receptor signaling pathway
    102177339 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102177339 (PPP3R2)
   04921 Oxytocin signaling pathway
    102177339 (PPP3R2)
   04924 Renin secretion
    102177339 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102177339 (PPP3R2)
   04720 Long-term potentiation
    102177339 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102177339 (PPP3R2)
   04380 Osteoclast differentiation
    102177339 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102177339 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102177339 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    102177339 (PPP3R2)
   05020 Prion disease
    102177339 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    102177339 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102177339 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102177339 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102177339 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    102177339 (PPP3R2)
   05163 Human cytomegalovirus infection
    102177339 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102177339 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102177339 (PPP3R2)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102177339 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 102177339
NCBI-ProteinID: XP_005684314
LinkDB
Position
8
AA seq 170 aa
MGNEASYPEEICSHFDEDEIKRLRKRFKKLDLDGSNALSVKEFTSIPELQKNPLVQRVID
VFDTDGDGQVDFQEFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttacccggaggagatatgctcgcactttgacgaagatgaaatt
aaaaggctgcgcaagcggtttaagaagctggacttggacggttccaacgctctgagcgtc
aaagagttcacgtccataccggagctgcagaagaacccgctggtgcagcgggtgatcgac
gtcttcgacaccgacggcgacggacaggtggacttccaggaattcatcttggggacctcc
cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac
atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg
ggggacaatctgaaagattggcagttacagcagctggtggacaaaaccatcatcctcctg
gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg
gaggtccacaagcacttggtgaccattgtgtga

KEGG   Capra hircus (goat): 102179767
Entry
102179767         CDS       T02910                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04720  Long-term potentiation
chx04724  Glutamatergic synapse
chx04728  Dopaminergic synapse
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102179767 (PPP3CC)
   04310 Wnt signaling pathway
    102179767 (PPP3CC)
   04370 VEGF signaling pathway
    102179767 (PPP3CC)
   04020 Calcium signaling pathway
    102179767 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    102179767 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102179767 (PPP3CC)
   04218 Cellular senescence
    102179767 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102179767 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    102179767 (PPP3CC)
   04660 T cell receptor signaling pathway
    102179767 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    102179767 (PPP3CC)
   04659 Th17 cell differentiation
    102179767 (PPP3CC)
   04662 B cell receptor signaling pathway
    102179767 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102179767 (PPP3CC)
   04921 Oxytocin signaling pathway
    102179767 (PPP3CC)
   04924 Renin secretion
    102179767 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    102179767 (PPP3CC)
   04728 Dopaminergic synapse
    102179767 (PPP3CC)
   04720 Long-term potentiation
    102179767 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    102179767 (PPP3CC)
   04380 Osteoclast differentiation
    102179767 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102179767 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102179767 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    102179767 (PPP3CC)
   05020 Prion disease
    102179767 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    102179767 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    102179767 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102179767 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102179767 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    102179767 (PPP3CC)
   05163 Human cytomegalovirus infection
    102179767 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102179767 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102179767 (PPP3CC)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102179767 (PPP3CC)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102179767 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 102179767
NCBI-ProteinID: XP_017907786
LinkDB
Position
8
AA seq 531 aa
MSGRNLHLSTTERVIKAVPFPPTQRLSLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQMTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDDELEDHYISSFQKGGTTVRKEIIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLD
RINERMPPRKDSQYFDGPAKLVQANAAHRSDKGRRASHDSEPCGGTGGSKT
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtctgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccgacccagcggcttagtttgaaggaagtatttgagaatgggaaacctaaaattgat
gttttgaaaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaaaata
atcaatgatggggctgccatactgagacaagagaagactatgatagaagtagatgctcca
atcactgtatgtggtgacattcatggacagttctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaatacacgctacctctttctgggtgactacgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagatcaatcatcccaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagaatattttaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtacgatgcgtgtatggaaacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctgtgtgtacatggaggaatgtcacct
gaaattacttgtttagatgacattcggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccctccgaggattatggcaatgaaaagacc
ttggaacactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttctgcagaacaataatttgctctcaataatcagagcccatgaagcccaa
gatgccgggtatcgaatgtacaggaagagccaaatgacgggctttccatcgctcattaca
attttctctgcacccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaacgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacgtggtctttgccttttgtcggggaaaaagttacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttccgatgatgaacttgaa
gatcactacatttcaagctttcagaaaggaggcactacagttcgcaaggagatcatcaag
aataaaatcagagctattgggaagatggcacgggtcttttcaattctccgggaagagagt
gagagcgtgctaactctcaagggcctgactcctacagggacactccctttgggtgtcctc
tcaggagggaagcagactattgagacagccacagtagaagcggtagaggcccgggaagcc
atcagagggttttcgcttcagcacaggatccggagttttgaagaagcccgaggtctggac
cgaattaatgagcggatgccaccccgcaaagatagccagtactttgatgggccggcgaaa
ctggtccaagccaacgctgcacacaggagcgacaagggaagaagagccagtcatgactca
gagccctgcggtggcactggtggatccaagacttaa

KEGG   Capra hircus (goat): 102182602
Entry
102182602         CDS       T02910                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04720  Long-term potentiation
chx04724  Glutamatergic synapse
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102182602 (PPP3R1)
   04310 Wnt signaling pathway
    102182602 (PPP3R1)
   04370 VEGF signaling pathway
    102182602 (PPP3R1)
   04020 Calcium signaling pathway
    102182602 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    102182602 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102182602 (PPP3R1)
   04218 Cellular senescence
    102182602 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102182602 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    102182602 (PPP3R1)
   04660 T cell receptor signaling pathway
    102182602 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    102182602 (PPP3R1)
   04659 Th17 cell differentiation
    102182602 (PPP3R1)
   04662 B cell receptor signaling pathway
    102182602 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102182602 (PPP3R1)
   04921 Oxytocin signaling pathway
    102182602 (PPP3R1)
   04924 Renin secretion
    102182602 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102182602 (PPP3R1)
   04720 Long-term potentiation
    102182602 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102182602 (PPP3R1)
   04380 Osteoclast differentiation
    102182602 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102182602 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102182602 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    102182602 (PPP3R1)
   05020 Prion disease
    102182602 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    102182602 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102182602 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102182602 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102182602 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    102182602 (PPP3R1)
   05163 Human cytomegalovirus infection
    102182602 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102182602 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102182602 (PPP3R1)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102182602 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 102182602
NCBI-ProteinID: XP_017910927
LinkDB
Position
11
AA seq 215 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAQHLCPLGKRWEKPCRHSRKTSDTDY
RDEIKPEKEAGCARPINTLKVEQKSVIITLRDIMY
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctacctgagttacaacagaatcccttagtacagcgagtaatagat
atattcgacaccgatgggaatggagaagtagactttaaagagttcattgagggagtctct
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg
gggaacaatctgaaagacacacagttacagcaaatcgtagacaaaaccataataaatgca
gataaggatggggatggaagaatatcctttgaagaattctgtgctcaacacttgtgccct
ctaggcaagaggtgggaaaagccctgtcgacattcaaggaaaacctctgatacggattac
agagatgaaatcaaacctgaaaaagaagcaggctgtgcaaggccaataaacactttaaaa
gtagaacagaaatctgtcattattaccctcagggatataatgtattag

KEGG   Capra hircus (goat): 102184033
Entry
102184033         CDS       T02910                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04114  Oocyte meiosis
chx04218  Cellular senescence
chx04310  Wnt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04720  Long-term potentiation
chx04724  Glutamatergic synapse
chx04728  Dopaminergic synapse
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05031  Amphetamine addiction
chx05152  Tuberculosis
chx05163  Human cytomegalovirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102184033 (PPP3CB)
   04310 Wnt signaling pathway
    102184033 (PPP3CB)
   04370 VEGF signaling pathway
    102184033 (PPP3CB)
   04020 Calcium signaling pathway
    102184033 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    102184033 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102184033 (PPP3CB)
   04218 Cellular senescence
    102184033 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102184033 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    102184033 (PPP3CB)
   04660 T cell receptor signaling pathway
    102184033 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    102184033 (PPP3CB)
   04659 Th17 cell differentiation
    102184033 (PPP3CB)
   04662 B cell receptor signaling pathway
    102184033 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102184033 (PPP3CB)
   04921 Oxytocin signaling pathway
    102184033 (PPP3CB)
   04924 Renin secretion
    102184033 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102184033 (PPP3CB)
   04728 Dopaminergic synapse
    102184033 (PPP3CB)
   04720 Long-term potentiation
    102184033 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102184033 (PPP3CB)
   04380 Osteoclast differentiation
    102184033 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102184033 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102184033 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    102184033 (PPP3CB)
   05020 Prion disease
    102184033 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    102184033 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102184033 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102184033 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102184033 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    102184033 (PPP3CB)
   05163 Human cytomegalovirus infection
    102184033 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102184033 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102184033 (PPP3CB)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102184033 (PPP3CB)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102184033 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 102184033
NCBI-ProteinID: XP_017897792
LinkDB
Position
28
AA seq 534 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDERLIYGNKKVGSAAARKEIIRNKIR
AIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGF
SPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHGAQ
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgttcctttccccccaacacatcgcttgacatct
gaagaagtatttgatatggatgggatacccagggttgatgttctgaagaaccacttagta
aaagaaggtcgggtagatgaagaaattgcacttagaattatcaatgagggtgctgccatt
cttcggagagagaaaaccatgatagaagtagaggctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcctgaagattctatatccaagtacattatttctcctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaaatattca
gaaagagtctatgaagcttgtatggaagcttttgatagcttgcctcttgctgcactttta
aaccaacaatttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcgtatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttattggttgcccaattttatggatgttttcaca
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaacgttctgagtatt
tgctctgatgatgaacttatgactgaaggcgaagaccagtttgatgaacggctcatatat
ggcaataaaaaagtaggttcagctgcagcccggaaagaaatcataagaaacaaaattcga
gcaattggcaagatggcaagggtcttctctgttctcagggaggagagtgaaagtgtgctg
acactcaagggcctgactcccacagggatgttgcctagtggagtgttggctggaggacgg
cagaccctgcaaagtgccacagttgaggctattgaggctgaaaaagcaatacgaggattc
tctccaccacatagaatctgcagttttgaagaggcaaagggtttggataggatcaatgag
agaatgccaccccggaaagatgctgtacagcaagatggtttcaattctctgaacaccgca
catgccactgagaaccacgggactggcaaccatggtgcccagtga

DBGET integrated database retrieval system