KEGG   Capra hircus (goat): 102177059
Entry
102177059         CDS       T02910                                 

Gene name
IFNE
Definition
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04622  RIG-I-like receptor signaling pathway
chx04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102177059 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102177059 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102177059 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102177059 (IFNE)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interferons
   102177059 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 102177059
NCBI-ProteinID: XP_013821322
UniProt: A0A452DVR6
LinkDB
Position
8
AA seq 193 aa
MINKAFFEIVLVLLASSTVCSQELKLVLCQQRRVNQESLKLLNELQTSSIQQCLLHRKNF
LLPQKSVNPHQYQKGQVLAILHEMLQQIFNLFRATSSLDGWEEGHTEKFLVELLQQLEYL
EALMRLQAKKKSDTLGSENLRLQVKMYFQRIHDYLESQDYSSCAWTIVKVEINRCLFLVF
PLTRKLSEQGMET
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattaacaaggctttctttgaaattgtgttggttctgttggcttcttccactgtttgc
tcccaagagctgaaactggttctttgccagcaaaggagagtgaaccaagagagtttaaaa
cttttgaatgaactgcagacctcgtcaattcagcagtgtctactgcacaggaaaaacttc
ctgcttccccagaagtctgtgaatcctcaccagtatcagaaaggacaagtactggccatt
cttcatgagatgcttcaacagatcttcaacctcttcagggcaacctcttctcttgatggt
tgggaggaaggtcacacagaaaagttccttgttgaacttcttcaacagctggaataccta
gaagcactcatgagactgcaagcaaagaagaaaagtgacaccttgggcagtgagaacctt
agattacaggttaaaatgtatttccaaaggatccatgattacctggaaagccaggactat
agcagctgtgcctggaccattgtcaaagtagaaatcaaccggtgtctgttcttggtgttc
ccactcacaagaaagctgagtgaacagggcatggaaacttga

DBGET integrated database retrieval system