KEGG   Capra hircus (goat): 102177271
Entry
102177271         CDS       T02910                                 

Gene name
PTPN11
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
chx  Capra hircus (goat)
Pathway
chx04014  Ras signaling pathway
chx04072  Phospholipase D signaling pathway
chx04360  Axon guidance
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04920  Adipocytokine signaling pathway
chx04931  Insulin resistance
chx05168  Herpes simplex virus 1 infection
chx05205  Proteoglycans in cancer
chx05211  Renal cell carcinoma
chx05220  Chronic myeloid leukemia
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102177271 (PTPN11)
   04630 JAK-STAT signaling pathway
    102177271 (PTPN11)
   04072 Phospholipase D signaling pathway
    102177271 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102177271 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    102177271 (PTPN11)
   04670 Leukocyte transendothelial migration
    102177271 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102177271 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102177271 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    102177271 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102177271 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102177271 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102177271 (PTPN11)
   05211 Renal cell carcinoma
    102177271 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102177271 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102177271 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102177271 (PTPN11)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102177271 (PTPN11)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    102177271 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 102177271
NCBI-ProteinID: XP_017916644
LinkDB
Position
17
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDAKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQASGDQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctactg
ttgacaagaggagttgacggcagtttcttggcgaggcccagcaaaagcaaccctggcgac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtacggaggagagaaatttgccactttggctgaattggtccagtat
tacatggaacatcatgggcaattgaaagagaagaatggagatgtcattgagctcaaatat
cctctcaactgtgccgatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagaaaaattattaactgaaaaaggaaaacatggtagctttcttgtgcgcgagagc
cagagccaccctggagattttgttctctctgtccgaactggagatgacaaaggggagagc
aatgatgccaagtctaaagtgacccacgtcatgatccgctgtcaggaactgaaatatgat
gttggtggaggagaacgatttgactctttgacagacctcgtggagcattacaagaagaat
cctatggtagaaacattgggcacagtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgtaaa
cttctctatagccggaaagagggtcagaggcaagaaaataaaaacaaaaatagatataag
aacatcctgcccttcgatcacaccagggtcgtcctccacgatggtgatcccaacgagccc
gtttcggattacatcaatgcgaacattatcatgcctgaatttgaaaccaaatgcaacaac
tcaaagcccaaaaagagttacattgccacacaaggctgcttgcagaacacagtgaatgac
ttctggaggatggtgtttcaagagaactcccgagtgattgtcatgacaacaaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgacgagtatgcactaaaagaatac
ggagtcatgcgcgttaggaacgtcaaggaaagtgccgctcacgactataccttaagagaa
cttaaactctcgaaggttggacaagctttactccaggggaatacggagagaacggtctgg
caataccactttcggacctggcctgaccacggtgtgcccagtgacccagggggcgtgctg
gactttctggaggaggttcaccacaagcaggagagcattgtggatgcggggcccgtggtg
gttcactgcagtgctggaattggccggacagggacgttcattgtgattgatattcttatt
gacatcatcagagagaaaggtgtcgactgtgacatcgacgttcccaaaaccattcagatg
gtgcggtcacagaggtcagggatggtccagacagaagcacagtaccgattcatctatatg
gctgtccagcattatattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaaggacacgaatacacaaatattaagtattccctgacggaccaggcaagtggggat
cagagtcccctgccgccttgtaccccaacaccgtcctgtgcagaaatgagagaagacaat
gctagagtctatgaaaacgtgggcctgatgcagcagcagaaaagcttcagatga

DBGET integrated database retrieval system