KEGG   Capra hircus (goat): 102177435
Entry
102177435         CDS       T02910                                 

Gene name
APC2
Definition
(RefSeq) APC2, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04810  Regulation of actin cytoskeleton
chx04934  Cushing syndrome
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05217  Basal cell carcinoma
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102177435 (APC2)
   04390 Hippo signaling pathway
    102177435 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102177435 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102177435 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102177435 (APC2)
   05206 MicroRNAs in cancer
    102177435 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102177435 (APC2)
   05225 Hepatocellular carcinoma
    102177435 (APC2)
   05226 Gastric cancer
    102177435 (APC2)
   05217 Basal cell carcinoma
    102177435 (APC2)
   05213 Endometrial cancer
    102177435 (APC2)
   05224 Breast cancer
    102177435 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102177435 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    102177435 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102177435 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102177435 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102177435 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102177435 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:chx04812]
    102177435 (APC2)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102177435 (APC2)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102177435 (APC2)
Cytoskeleton proteins [BR:chx04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     102177435 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 Suppressor_APC APC_r Arm SAMP bZIP_1 Wtap Sec2p HALZ Herpes_BLRF2
Other DBs
NCBI-GeneID: 102177435
NCBI-ProteinID: XP_017905926
LinkDB
Position
7
AA seq 2279 aa
MGLLGLLSLLHSAFFGDQALQALKMTSSVAAYEQLVRQVEALKAENSHLRQELRDNSSHL
SKLETETSGMKAVLQHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLKFQPPAL
APEPTTRTPEGSPVHSSGPSKENFGELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYY
SQLQGLSKRLDELPHVETQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRA
SRLEQIDKELLSAQDRVQQTEPQALLAVKSMPMDEDAENEVPTHPEDGAPQPGNSKVEVV
FWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAGVGGRNGTPG
APGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPE
GGGTGAAPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDHEMHKMTRD
PLNLALRRYAGMTLTNLTFGDVANKAALCARRGCMEAIVAQLASESEELHQVVSSILRNL
SWRADINSKKVLREVGSMTALMQCVLRATKESTLKSVLSALWNLSAHSTENKAAICQVDG
ALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTS
HSLTIVSNACGTLWNLSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLA
HRPAKYQPAATAVSPGSCAPSLYVRKQRALEAELDTRHLAQALDHLEKQGLPEAEAASKK
PLPPLRHLDGLAQDYASDSGCFDDDDAPSLAAAATAAEPASPAVLSLFLGSPFLQGQALA
RAPPTRRGGLEVEKEAGGEAAVAARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSG
DPGQEAPREGRAQSCSPCRGPEAGRREVGSSRAHPLLRLKAAHASLSNDSLNSGSTSDGH
CPREHSRPCSLAALAEHREGPARGQARPSRLDLSLPSGQAEPEARDAKATDAHVRTIKLS
PTYQHVPLLEGTTRVGVGSLTPGARKQAWLSTEGLSSVPEKLMVEKAPLCLSRCSSLSSL
SSAGRPGPSEAGDLDESDSSLEGLEESGPGEAELDGAWRGPGTTSLPMAIPAPQRGRGLG
VEDATPSSSSENCVQETPLVLSRCSSVSSLGSFESPSIASSIPSDPCSGLGSGTVSPSEL
PDSPGQTMPPSRSKTPPLAPAPPGEREATQFSLQWESYVKRFLDIADCRERCRLPSELDA
GSVRFTVEKPDENFSCASSLSALALHELYVQKDVELRLLPPACPERGSGGGGGPGHRRRD
EASGCLEGPASTDQELELLRECLGGAVPARLRKVASALVPGRRALPVPVYMLVPAPARED
GSCTDSAEGTPVNFSSTASLSDETLQGAPKDGRRLDGQKPAGHAASTRQSAGQRHRVGGM
GRSTEQPQGAGRSRAGLELPLRRPPSACRDTDSSRPGREHGDGALQSLCLTTPTEEAVYC
FYGNDSDEEPATAVAAAPPRRASAIPRAVKRERPAGARKEVQAVPKAVPKAAPPTRAQPS
LIADETPPCYSLSSSASSLSEPEPSECMASRARVHKPGLTKDLVPGGRKDGSLSPRAEAE
LLRRCIGSALPRRQPQVSGPRRRPPREAQPKERAAEGPRERGEEAISSDHASDLDSIEWR
AIQEGANSVATWLHQAAAAAAREASSESDSVLSFATGQSVGSTLQPTLHRKGCRPRAERQ
ASGALRPEKPEGALTQRSSGPEKPRGTQKAPNGVPAVLRGHTVIYMPSPATRAQPRGAPG
SRIVARKMGAPSPVQPVAPTKAPSLGQQRSRSLHRPGKISELSTLSPPQRSATPPARLAK
TPSSSSSQTSPASQPLPRRSAPAAQPAGPLPGPKASPVPKTPARALLAKQHKTQKSPVRI
PFMQRPARRGPPPLARAAPEPGPRGRVGTEGGPAARGGRLGLVRVASARSSGSESSDRSG
FRRQLTFIKESPGLLRRRRSELSAPAPEATNPTTQAASPCRGRPTLPAVFLCSSRCDELR
AGSRQAPAPPRAHAARPRPSERQPRRTSSESPSRLPVRTPAAGPETVKRYASLPHISVAR
RPDATSPEPAADATRRSSAGEAGPLPRVAAPGTTWRRIRDEDVPHILRSTLPARALPLLG
SPPEDGPAGPPQRKTSDAVVQTEDFAAAKINSSTSPSMESRAPPXATASGPTSLLGSDVD
GPPAKAPAPTPFVPASRHGSPSRSARVPPFNYVPSPMVAAIADSAVEKAPTPVPTSLLE
NT seq 6840 nt   +upstreamnt  +downstreamnt
atggggctcctggggctgctgagcctactgcactcggccttctttggggaccaggcactg
caggcgctgaagatgacgagctccgtggcggcctatgagcagctggtgcggcaggtggag
gccttgaaggccgagaacagtcacctgcggcaggagcttcgggataattcaagccacctg
tccaagctggagacagagacgtcgggaatgaaggcggtcctgcagcacttacagggcaag
ctggagcaggaggctcgtgtgttggtgtcctccgggcagactgaggtgctggaacagctg
aaagccctgcagatggacatcaccagcctgtataacctcaagttccagcccccagctctg
gcccccgaacccactacccggacccctgagggaagcccggtgcacagctctgggccctcc
aaggagaactttggggagctgagccgggctaccattcggctcttggaggaactggacagg
gaacggtgtttcctgttgaatgagattgagaaggaggaaaaggagaagctctggtattac
tcgcagttgcaggggctatctaagcgcttggatgaactcccgcacgtggagacgcagttc
tcaatgcagatggatctgatccggcaacagctggaattcgaggcccagcacatccgctcg
ctgatggaggagcgcttcggcacctctgacgagatggtgcagcgggcgcagatccgtgct
tcccgcctggagcagatcgacaaggaactgctgtccgcccaggaccgggtgcagcagacc
gagccccaggccttgctggcagtgaagtcgatgcccatggacgaggacgccgagaatgag
gtccccacgcaccctgaggatggtgcccctcagccaggcaacagtaaggtggaggtggtc
ttctggctcctgtccatgctggcaacgcgggaccaggaggacacggcacggacgctgctc
gccatgtccagctcacccgaaagctgcgtggccatgcgccgctcaggctgtctgccactg
ctgctgcagatcctgcacggcaccgaggctggggttgggggtcgcaacgggacccccggg
gctccaggagccaaggacgcacgcatgcgcgccaacgcagcactgcacaatattgtcttc
tctcagcccgaccaggggctggcacgcaaggagatgcgagtgttacatgtgctggagcag
atccgtgcctactgcgagacctgctgggactggctgcaggcccgggatggcgggcctgag
ggcggcggcactggtgctgcaccagtgcccattgagccacagatctgtcaggccacctgc
gctgtgatgaagctgtcctttgatgaggaataccgccgcgctatgaatgagctgggtggg
ctgcaggcagtggcggagttactgcaggttgaccatgagatgcacaagatgacccgggac
cctctcaacctggccctgcggcgatacgctggcatgaccctcaccaaccttaccttcggg
gacgtcgccaacaaggctgcactgtgtgcccgccggggctgcatggaggccattgtggcc
cagctggcatctgagagtgaggagctgcaccaggtcgtgtctagcatcctgcgcaacctg
tcctggagggctgacatcaacagcaagaaggtgctgagggaggtgggcagcatgactgcc
ctgatgcagtgcgtccttcgagccaccaaggagtccaccctgaagagcgtgcttagcgcc
ctgtggaacctctcagcgcacagcacagagaacaaggcggccatctgccaggtggatggt
gccctcggcttcctggtgagcacactgacttacaagtgccagagcaactcgctagccatc
attgagagtggtggtggcatcctgcgcaatgtgtccagcctcatcgccaccagagaggac
tacaggcaggtgctgcgagaccacaattgcctgcagacgctgctgcagcatctgacgtcg
cacagcctgaccatagtgagcaatgcatgcggcacactctggaacctgtcggcccgcagc
cctcgcgaccaggagctgctgtgggacctgggcgccgtgggcatgttgcggaacctggta
cactccaagcacaagatgatcgccatgggcagcgccgccgcgctgcgcaacctgctggct
caccggcctgccaagtaccagccggcggccaccgcggtctccccgggctcctgcgcgccc
agcctgtatgtgcgcaaacagcgcgcactggaggccgagctggacacacggcacctggcg
caggcgcttgaccacctggagaagcagggcctgccggaggccgaggccgcctccaagaag
cccctcccgcccctgcgccacctggacggcctggcccaggactacgcctctgactcaggc
tgttttgacgacgacgatgcgccctccctggctgctgctgccactgctgcagagcccgcc
agccccgcagtgctctccctcttcctgggcagccccttcctgcagggccaggcgctggcc
cgagccccgcccacccgccgaggaggcctggaggtggagaaggaggcgggtggggaggca
gccgtggcagctagggccaaggccaagctggcgctagcagtggctcgcatcgacaggctg
gtagaggacatctcggccctgcacacttcatctgacgacagcttcagcctcagctccggg
gaccctggccaggaggccccgcgagaaggccgtgcccaatcctgctcaccttgcaggggg
cctgaggcggggcgtcgggaagtgggcagcagccgggctcacccactgctgcggctcaag
gcagcccacgccagcctttccaatgacagtctcaacagcggtagcaccagtgatgggcac
tgtcctcgcgaacactcacggccctgctcgctggctgctctggccgagcaccgagagggg
cccgcacgtggtcaggcgcggcccagccggcttgacctcagcctgcccagcggccaggct
gagcctgaggcccgggatgccaaggccacagatgcccatgtgcgtaccatcaagttgtcg
cccacctaccagcatgtgccgctgctggagggcaccaccagggtgggtgtggggtccctg
acccctggggcccgaaaacaggcctggctgtccacagagggcctgagcagtgtgcctgag
aagctaatggtcgagaaggcacccctctgcctgtcccgctgcagctcgctgtcctcgctg
tcctcagctggccgcccggggcccagtgaggctggggacctagacgagagcgactcatct
ctggaggggctggaggagtctggccctggtgaggcagagctggatggggcctggcggggc
ccagggaccacctccctgcccatggccatcccagcgccccagaggggtcggggcctgggg
gtggaggatgccacgccgtccagctcctctgagaactgtgtgcaggagacaccgttggtg
ctgagccgctgcagctcagtcagttcactgggcagcttcgagagtccatccattgccagc
tccatccccagtgacccgtgcagcgggctgggcagtggcacagtcagccccagtgagctg
cctgatagccccgggcaaaccatgccgccgagccgcagcaagacaccgccactggctcca
gcaccaccgggcgagcgggaggccacccagttcagccttcagtgggagagttatgtgaag
cgcttcctggacatcgccgactgccgagagcgctgccggctgccctccgagctggatgca
ggcagtgtgcgtttcactgtggagaagcccgatgagaacttttcatgtgcctccagcctc
agcgcattggccctgcatgagctctacgtgcagaaggacgtggagctgcggttactgccc
cctgcctgcccagagcgcggcagtgggggaggcggaggcccggggcaccgccgacgggac
gaggccagtggctgtctggaagggccagcgtccaccgatcaggagctggagctgctgcgt
gagtgcctgggtggggccgtgcctgcccggctccgcaaggtggcctcagcactcgtgcct
ggccgccgtgcgctgcccgtgccggtctacatgctggtgcctgcccccgcccgtgaggat
ggctcctgcactgactcggccgagggcactccagtcaacttctccagcaccgcttccctc
agtgacgagaccctgcagggagcccccaaggatggtaggcgtttggatgggcagaaaccc
gcaggtcatgccgcctccactaggcagtctgctgggcagcggcacagggtggggggcatg
ggccggagcacagagcagccccagggggctggcaggagccgggcagggctagagctgccc
ctccgccggcccccaagcgcctgcagggatactgacagctcccgcccaggccgggagcat
ggggacggggctctgcagtctctgtgcctcacaacgcccaccgaggaggctgtgtactgt
ttctatggcaatgactcggatgaggagccggccacggcggtggcagcagcacccccacgg
cgggcatccgcgatcccccgggcggtaaagagggagcgcccggctggtgccaggaaggag
gtgcaggctgtgcccaaggctgtacccaaggcagcaccacccacccgggcccagcccagc
ctcattgcagatgagacaccaccgtgctactccctgagctcctccgccagctccctcagc
gaacctgagccctccgagtgcatggccagtcgggcccgggtccacaagccagggctcacc
aaggacctggtccccgggggcaggaaggatggctccctcagcccgcgggccgaggcagag
ctgctccggcgctgcatcggctcagctttgcccaggcgccagccccaggtgtccggccca
aggcgtcgcccaccccgagaggcccagccaaaggagcgtgcagcagaggggccccgggag
cgcggtgaggaggcaatcagctcagaccatgcctcagacctggacagcatcgagtggcgt
gccatccaggagggcgccaattctgttgccacatggttgcaccaggccgcagcagcggct
gcccgcgaggcctcctcagagtctgattccgttctgtcctttgcaacagggcagtctgtg
ggttccaccctgcagcccaccctgcataggaaggggtgtcggccaagggcagagcgccag
gcgagtggtgccctgcggccagagaaaccagaaggggccctcacccagcgcagcagtggg
ccagagaagccgcgtggcactcagaaggccccaaatggggtgccagcagtgctccgggga
catacagtgatctacatgcccagccccgccacccgggcacagcccagaggtgcccctggt
tcccgcattgtggcaagaaagatgggagcgcccagccccgtgcagccagtggcccccact
aaagcccccagcctagggcagcagcggtctaggagcctgcaccggcctggcaagatctca
gagctgtcaacgctcagccccccgcagagaagtgccacaccaccagcccgccttgcgaag
accccgtcgtcaagttcctctcagacctcaccggcctcccagcctctgcccaggaggtca
gcccctgctgcccagcctgcagggcccctgcctggccccaaggcctccccagtgcccaag
actccagcaagggccctgctggccaagcagcacaagacgcagaagtcacccgtgaggatc
ccctttatgcagaggcccgccaggcgggggccgccgcccttggctagggcagccccggag
ccaggccccaggggccgggtgggcacagaaggcggccctgcagcccgagggggccgcctg
ggcctggtgcgcgtggcctccgcccgctccagcggcagcgaatcctccgaccgctcgggt
ttccggcggcagctgacctttatcaaggagtcgccgggcctgctgcgccgccgacgctct
gaactgtccgcacccgcacccgaagccaccaacccgaccacccaggctgcctcgccctgc
cgcggccggcccacactacccgctgtcttcctctgctcctcgcgctgtgatgagctgcgg
gcaggctcccggcaggccccggcccctccgcgggcccacgcggcccggccccgccccagc
gagcggcagcctcggcgcactagctccgagagcccgtcccgcctgcccgtccgcacgccg
gccgccgggcccgagacggtcaagcgctacgcctccctgccccacatcagcgtggcccgc
agaccggatgccaccagccccgaacctgcggcggacgccacacgccgcagcagcgcaggg
gaggccgggccgctgcctagggtggccgcgccgggcaccacgtggcgccgcatccgggac
gaggacgtcccgcacatcctgcggagcacgctgcctgcgcgcgccctaccgctgctgggc
tcccctcccgaggacggcccagccggcccgccgcagcgcaagaccagcgacgccgtggtc
cagactgaggacttcgcggctgcgaagatcaactccagcacgtccccgagcatggaaagc
agggcgccccccnaggccacggccagcggccccacctcccttcttggcagcgacgtggat
gggccacccgctaaggcgcccgcccccacccccttcgtccccgccagccggcacggctcc
cccagccgctccgcccgcgtcccccctttcaactacgtgcccagccccatggtggcggcc
atcgctgactctgccgtggagaaggcccccacccccgtccccaccagcctcctggaatag

KEGG   Capra hircus (goat): 102184724
Entry
102184724         CDS       T02910                                 

Gene name
APC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
chx  Capra hircus (goat)
Pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04810  Regulation of actin cytoskeleton
chx04934  Cushing syndrome
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05217  Basal cell carcinoma
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102184724 (APC)
   04390 Hippo signaling pathway
    102184724 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102184724 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102184724 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102184724 (APC)
   05206 MicroRNAs in cancer
    102184724 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102184724 (APC)
   05225 Hepatocellular carcinoma
    102184724 (APC)
   05226 Gastric cancer
    102184724 (APC)
   05217 Basal cell carcinoma
    102184724 (APC)
   05213 Endometrial cancer
    102184724 (APC)
   05224 Breast cancer
    102184724 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102184724 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    102184724 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102184724 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102184724 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102184724 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102184724 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:chx04812]
    102184724 (APC)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102184724 (APC)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102184724 (APC)
Cytoskeleton proteins [BR:chx04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     102184724 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 102184724
NCBI-ProteinID: XP_013822137
UniProt: A0A452FYS5
LinkDB
Position
10
AA seq 2880 aa
MFTPLCSSAVAALPASVPPCAVGSRSCGGGRGCVRQERKRPGCVRASVRGASVWQEVLKQ
LQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGEC
SPVPMGSFPRRGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRID
SLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILR
IRQLLQSQATEAERSSQSKHEAGSREAERQNEGQGVAEISMATSGGGQGSTTRTDHETAS
VLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLL
EQIRAYCEACWEWQEAHEQGLDQDRNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELG
RKATRGISSQELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGD
VANKATLCSMKGCMRALVAQLQSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKAL
MECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAII
ESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNP
KDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSL
HVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDTNRHDDNRSD
NFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGISLGNYHPATENPGT
SSKRGLQIPTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCGTDERSALRRSSTTHTHA
NTYNFTKSENSNRTCPIPYAKVEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDES
KFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARP
KHILEDEIKPNEQRQSRSQSTAYPVYPESSDDKHLKFQPHFGQQECVSPYRSRAANGSET
NRVGSNHGISQNVTQSLCQEDDYEDDKPTNYSERYSEEGQHEEEERPTNYSIKYSEEKHH
VDQPIDYSLKYTTDIPSSQKPAFSFSKNSSGQSTKTEHISSSSENTSTTSSNAKRQNQLH
PSSAQSRSGQTPKATSSSCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEVGCD
QTTQEAESANTLQIAEIKDNSGPRSNEDSVSKVPTVSQHIRTKSSRLQASGLSSESARHK
AVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPC
SGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPPPPPPQTVQTKQEVPKNKAPSAEKRES
GPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIM
PPVQENDNGNETESEQPEESNENQEKEAEKPTDSEKDLLDESDDDDIEILEECIISAMPT
KSSRKAKKPAQTSSKLPPPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVE
GTPINFSTATSLSDLTIESPPNELAAGEGVGAGAQSSEFEKRDTIPTEGRSTDEAQRGNA
SSVTVPELDDNKTEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASMSSSGTNKNQL
DGKTKKPTSPVKPIPQSSEYRTRVRKNTDSKNNLNAERNFSENKDSKKQHLKNNSKDLND
KLPNNEDGVRGSFTFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGK
ENKESEAKVTSHTELTSNQQSASKTPAVTKQPINRGQSKPVLQKQSTFPQSSKDMPDRGA
ATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNNKENEPIKETEPPASQGEPGKPQA
SGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKPDNEKHS
PRNMSGILAEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACL
SRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFMNNKGPRILKPGEKSTLETKKTESE
NKGIKGGKKVYKSLITGKVRSNSEISSQMKQPLPTNMPSISRGRTMIHIPGVRNSSSSTS
PVSKKGPPLKTPASKSPSEGQPATTSPRGTKPSVKSELSPVTRQASQTAASNKGPSRSGS
RDSTPSRPVQQPLSRPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKM
SYTSPGRQMSQQNLAKQTGLSKNGSGIPRSESASKGLNQMSNNNGSNKKVELSRMSSTKS
SGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAHTPVL
SPSLPDMSLPTHSSVQSGGWRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRS
GTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKQVNSISGSKQTKEN
QVSTKGTWRKIKESEISPTNSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDC
PINNPRSGRSPTGNSPPVIDTVSEKGSPNPKDSKDNQGKQNVSNGSAPTRTVGLENRLNS
FIQVDPPDQKGTETKPGQSNNPVPTSETNESSIAERTPFSSSSSSKHSSPSGTVAARVSP
FNYNPSPRKSSTDGTSARPSQIPTPVSNNTKKRDSKPDSTEPSGTQSPKRHSGSYLVTSV
NT seq 8643 nt   +upstreamnt  +downstreamnt
atgttcacccccctctgctcgagtgcggtcgccgctttgcctgcttcggtgccgccctgt
gctgtcgggtcccggagctgcggcggcggcaggggctgtgtccggcaggagaggaagcgc
ccgggctgcgtccgtgcttctgtccgcggggcgagcgtctggcaggaagtacttaaacaa
ctacaaggaagtattgaagatgaagctatggcttcttctggacagattgatttattagag
cgtcttaaagaacttaacttagatagcagtaatttccctggagtgaaactacggtccaaa
atgtccctccgttcttacggaagccgagaaggatctgtatctagtcgctcaggagagtgc
agtcccgttcctatgggttcatttccaagaagagggtttgtaaatggaagcagagaaaat
accggttatttagaagaacttgaaaaagagagatcattgcttcttgctgaccttgacaaa
gaagaaaaggaaaaagactggtattatgctcaacttcagaatctcactaaaagaatagac
agccttcctttaactgaaaatttttccttgcaaacagatatgaccagaaggcagttggaa
tatgaggcaaggcaaatcagagttgcaatggaagaacagctaggtacttgccaggatatg
gaaaaacgagcacagcgaagaataaccagaattcaacaaatagaaaaggacatacttcgt
atacgacagcttttacagtcccaagcaacagaagcagagaggtcatctcagagcaagcat
gaagcgggctcccgtgaagctgaacggcagaatgaaggtcagggagtggcagaaatcagc
atggcaacctcgggtggcggccagggctcaacgacacgaacagaccatgaaacagccagt
gttttgagttctagtagcacacactctgctcctcgaaggctgacgagtcatctgggaacc
aaggtggaaatggtgtattcattgttgtcaatgcttggtactcatgataaggatgatatg
tcgcgaactttgctagctatgtctagctcccaagacagctgtatatccatgcgacagtct
ggatgtcttcctctcctcatccagcttttacatggcaatgacaaggactctgtgttgctg
ggaaattcccggggcagtaaggaggctcgggccagggccagcgcagcgctccacaacatc
atccactcacagcccgatgacaagaggggcaggcgtgagatccgagtcctccatcttttg
gagcagatacgagcgtactgcgaagcctgctgggagtggcaggaagcccacgaacaaggc
ctggaccaggacagaaatccaatgccagctcctgttgaacatcagatctgtcctgctgtg
tgtgttctaatgaaactttcgtttgatgaagagcatagacatgcaatgaatgaacttggt
aggaaggctacccggggcatttcatcccaggagctagggcaggggctttcagggggacta
caggccattgcagaattattgcaagtggactgtgaaatgtatgggcttactaatgaccac
tacagtattactttaagacgatatgcaggaatggctttgacaaatttgactttcggagat
gtagctaacaaggctactctctgctctatgaaaggctgcatgagagcactcgtggctcag
ctccagtccgagagtgaggacttgcagcaggttattgcgagtgttttgaggaatctgtct
tggagagcagatgtaaatagtaagaagactttgcgtgaagttggaagtgtgaaagcactg
atggaatgtgctttggaagtgaaaaaggagtcaaccctcaagagtgttttgagtgcctta
tggaacctgtcggcacactgcactgagaataaagccgacatatgtgctgtagacggcgcg
cttgcgtttctggttggcactctcacttatcgcagccagaccaacactttagccatcatt
gaaagtggaggtggcatcttacggaacgtatccagcttgatagctacaaatgaggaccac
aggcaaatcctaagagagaataattgcttacagaccttattacaacacttgaaatctcac
agtttgacaatagtcagtaatgcatgcggaaccttgtggaatctctcagcaagaaaccct
aaagaccaggaagcattgtgggacatgggagcggtcagcatgctcaagaacctcattcat
tcaaagcacaagatgattgctatgggaagtgctgcagctttaaggaatctcatggcaaat
agacctgcaaagtataaagatgccaatatcatgtctcctggttcaagtctgccttctctt
catgtcaggaaacaaaaggccctggaagcagaattagatgctcagcatttatcagaaact
tttgacaatattgacaatttaagtcccaaagcatctcatcgtagtaagcagagacacaag
caaaatctctatggtgactatgtttttgacaccaatcgacatgatgataacaggtcagac
aattttaatactggaaacatgactgtcctatcaccatacttaaatactacagtattgccc
agctcttcttcatcaaggggaagtttagatagctctcgttctgagaaagatcgaagtttg
gagagagaacgaggtattagcctaggcaactatcacccagcgacagaaaatccaggaacc
tcttcaaagcgaggtttgcagattcctaccactgcagcccagattgccaaagtcatggaa
gaagtatcagctattcatacctcccaggaagacagaagttctgggtctaccacagaacta
cactgtgggacagatgagaggagtgcactcagaagaagctctaccacccacacacatgca
aacacttacaactttaccaagtcagaaaactcaaacagaacatgtccaataccatatgcc
aaagtggaatataagagatcttcaaatgatagtttaaacagtgtcagcagtagtgatggt
tatggtaaaagaggtcagatgaaaccttcaattgaatcctattctgaagatgatgaaagt
aaattttgcagctatggtcagtatccagctgacctagcccataaaatacatagtgcaaat
catatggatgataatgatggagagctagatacaccgattaattatagtcttaaatattcc
gatgaacagttgaactctgggaggcagagcccttcacagaatgaaagatgggcaagaccc
aaacatatactagaagatgaaataaaaccaaatgagcagagacaatcaaggagtcaaagc
acagcttatcctgtatatcctgagagcagcgatgataaacatctcaagttccaaccacac
tttgggcagcaggaatgtgtttccccatacaggtcaagagcagccaatggatctgaaaca
aatcgagtaggctctaatcatggaattagtcaaaatgtgacccagtctttgtgtcaagaa
gatgactatgaagatgataaaccaaccaactatagtgaacgttactctgaggaagggcag
catgaggaagaagagagaccaaccaattatagcataaaatacagtgaagaaaaacatcac
gtggatcagcctattgattatagtttaaaatacaccacagacattccttcttcacagaaa
ccagcattttcattctcaaagaattcatctggacagagcacaaaaactgaacacatctct
tcaagcagcgagaatacgtccacaacttcatctaatgccaagaggcagaatcagctgcat
ccaagctcagcacaaagcagaagtgggcagaccccaaaagccacctcttcctcttgcaaa
gtcccctctatcaaccaagaaacaatacagacttactgtgtagaagataccccaatatgc
ttttcaagatgcagttcattatcatctttgtcatctgctgaagacgaagtagggtgtgat
cagacaacgcaggaagcagagtccgctaacactctgcagatagccgaaatcaaggacaac
agcggacctaggtcaaatgaagattctgtgagtaaagttccaacagtgtcacagcatatt
agaaccaaatccagcagactccaggcttctggtctgtcttcagagtcagccaggcacaaa
gctgttgaattttcttcaggggccaaatctccttccaagagtggtgctcagacacccaaa
agtccgccagagcactacgttcaggagaccccactcatgttcagcagatgtacttcggtc
agttcactcgatagttttgagagccgctcgattgccagctctgttcagagtgaaccctgc
agtggaatggtaagtggcattataagccccagtgacctcccagatagccctggacaaacc
atgccaccaagcagaagtaaaacccctcctcctcctccacctccacctcctcctcagaca
gttcaaacgaagcaggaagtacctaaaaataaagcacctagtgctgaaaagagagaaagt
ggacctaagcaagccgcagtaaatgctgcagtacaaagggtccaggttcttccagatgct
gatactctgttacattttgccacagagagtactcctgatggattttcttgttcatctagc
ctgagtgcactgagccttgatgagccatttattcagaaagatgtggaactaagaataatg
cctccagttcaggaaaatgacaacgggaatgaaacagaaagtgagcagcctgaagaatcc
aatgaaaaccaggaaaaagaggcagaaaaacccactgattctgaaaaagatcttttagat
gagtcagatgatgatgatattgaaatactagaagagtgtataatttctgccatgccaaca
aaatcttcacgcaaagccaaaaaaccagcccagactagttcgaaattacctccacctgtg
gcaaggaaaccaagtcagctccctgtatacaaacttctgccatcacagaacaggttacag
gcacaaaagcatgttagttttacaccaggagatgatatgccacgggtgtattgtgtagaa
gggacacctataaacttttccacagctacatctctgagtgatctaacgatagaatcccct
ccaaatgagttagctgctggagaaggggttggagcaggggcacagtcaagtgaatttgag
aaacgagataccattcctaccgaaggcagaagtacagatgaggctcaaagagggaacgcc
tcatctgtcactgtacctgaactggatgacaataaaacagaagaaggtgacattcttgca
gaatgcatcaattccgctatgcccaaaggaaaaagtcacaagcctttccgtgtgaaaaag
attatggaccaggtccaacaagcatctatgtcttcatctggaactaacaaaaatcaatta
gatggtaagacaaagaaaccgacttcaccagtaaaacctataccacaaagttctgaatac
aggacacgtgtaagaaaaaatacagactcaaaaaataatttaaatgccgaaagaaatttc
tcagaaaacaaagactcaaagaaacagcacttgaaaaataactccaaggacctcaatgat
aaactgccaaataatgaagacggagtcagaggaagttttacttttgattcacctcatcac
tacacacccattgaaggcactccatactgtttttcacgaaatgactctttgagttctcta
gattttgacgatgatgatgttgacctttccagggaaaaggctgaattaagaaaggggaag
gaaaataaagaatcagaagctaaagtgaccagccacacagaactaacctcaaaccaacaa
tcagctagtaagacaccagctgttacaaagcagccaataaacagaggtcagtctaaaccc
gtgctgcagaagcagtccacttttccccagtcttccaaagatatgccagacagaggggca
gcaacagatgagaaattacagaatttcgctattgaaaatactccagtttgcttttctcga
aattcctctctaagctctcttagtgacatcgatcaagaaaacaacaacaacaaggaaaat
gaacctatcaaagagacagagccccctgcctcacagggagaaccaggtaagccccaggcc
tcaggttatgctcctaaatcatttcacgtggaagacacccctgtttgtttctcaagaaac
agttctctcagttctcttagcattgattctgaagatgacctgttgcaggaatgtataagt
tctgcaatgccaaaaaagaaaaagccttcaaggctcaagcctgataatgaaaagcatagt
cccagaaatatgagtggcatattagcggaagatttgacactcgatttgaaagatatacag
agaccagattcagaacacggtttatccccagattcagaaaattttgattggaaagctatt
caggaaggtgcaaattccatagtaagtagtttacatcaagctgctgctgctgcatgttta
tctcgacaagcttcatctgattcagattccatcctttcgctgaaatcgggcatctctctg
ggatcaccatttcatcttacacctgatcaagaagaaaaaccctttatgaataataaaggc
ccacgaattctaaaacctggggagaaaagtacattggaaactaaaaaaacagaatctgaa
aataaaggaataaaaggaggcaaaaaggtttataaaagtttgattactggaaaagttcga
tctaattcggaaatttcgagccaaatgaaacaaccccttccaacaaacatgccttcaatc
tctcgaggtaggacaatgattcatattccaggagttcggaatagctcttcaagtacaagc
ccagtttctaaaaaaggcccacccctcaagactccagcctccaaaagccctagtgaaggt
cagccggctaccacctctcccagaggaaccaagccatcagtgaagtcagaattaagccca
gttacaaggcaggcatcccagacagcggcatcaaacaaaggaccttctagatcaggatct
agagattccactccttcaagacccgtccagcaaccattaagtagaccaatgcagtctcca
gggcgaaactcaatctctcctggtagaaatggaataagtccccctaacaaattatctcaa
ctaccaaggacgtcatcccctagtactgcttcaactaagtcctcaggttctgggaagatg
tcttacacgtctcctggcagacagatgagccagcagaacctcgccaaacaaacgggctta
tccaagaatggcagtggtatcccaaggagtgaatctgcctccaaagggctaaatcaaatg
agtaataataacggatccaataaaaaagtagaactttccagaatgtcttcaacaaagtca
agtggaagtgaatccgataggtcagagagacctgtattagtacgccaatcaactttcatc
aaagaagctccaagcccaaccctaaggagaaaactggaggaatctgcttcatttgaatct
ctttctccatcttctagaccggattctcccacacggtcccaggcacacactccagtttta
agtccttcccttcctgatatgtctctacctacacattcgtctgttcagtctggtggatgg
cgaaaactcccacctaacctcagtcccaccatagagtacaacgatggaagaccagtaaag
cgccatgatatagcgcgctctcattccgaaagtccttccagacttcccatcaataggtca
gggacctggaaacgtgagcacagcaaacactcatcatcacttcctcgagtaagcacttgg
agaagaactggaagttcatcctcaattctttctgcttcatcagaatctagtgaaaaggca
aaaagtgaggatgaaaaacaagtgaactctatttcaggaagcaaacaaactaaagaaaac
caggtatccacaaaaggaacatggagaaaaataaaagaaagtgaaatttctcccacaaat
agtacgtctcagaccacttcttcaggtgctgcaaatggtgctgaatcaaaaactctgatt
tatcaaatggcacctgctgtttctaaaacagaggatgtttgggtgagaattgaggattgc
cccattaacaaccctagatctggaagatctccaacaggaaattctccccccgtgattgac
actgtttcagaaaagggaagcccgaaccctaaagattcaaaagataatcagggaaaacaa
aatgtgagcaatggtagtgcccctacacgcaccgtgggtctggaaaaccgcctgaattcc
tttattcaggtagatcccccagaccaaaaaggaactgagacaaaaccgggacaaagtaat
aaccctgtccctacatccgagactaatgaaagttctatagctgagcgtaccccgtttagt
tctagcagctcaagcaagcacagttcaccaagtgggactgtcgccgccagggtgagtcct
tttaattacaacccaagcccaaggaaaagcagcacagatggcacttccgcccgaccgtct
cagatcccaacgccagtgagtaacaacacaaagaaacgcgactcaaaacccgacagcacg
gaacccagtgggactcagagtccgaaacgtcattccgggtcttaccttgtgacatctgtg
tga

DBGET integrated database retrieval system