KEGG   Capra hircus (goat): 102177713
Entry
102177713         CDS       T02910                                 

Gene name
CEBPA
Definition
(RefSeq) CCAAT/enhancer binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04932  Non-alcoholic fatty liver disease
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102177713 (CEBPA)
   05202 Transcriptional misregulation in cancer
    102177713 (CEBPA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102177713 (CEBPA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102177713 (CEBPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102177713 (CEBPA)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    102177713 (CEBPA)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin TolA_bind_tri bZIP_Maf GAS Lipoprotein_20 DivIC Hema_stalk
Other DBs
NCBI-GeneID: 102177713
NCBI-ProteinID: XP_017917767
UniProt: A0A452E8P6
LinkDB
Position
18
AA seq 353 aa
MESADFYEAEPRPPMSSHLQSPAHAPSSAAFGFPRGAGPSQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGGGNDFDYPGAPVGPGGAVMPG
GTHGPPPGYGCAAAGYLDSRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPHSHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAA
GLPGPGGALKGLAAAHPDLRAGGGGGGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQ
RNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agccccgcacacgcgcccagcagcgccgctttcggctttccccggggcgcgggcccctcg
cagccccccgccccacctgccgccccggagcctctggggggcatctgcgaacacgagacg
tccatcgacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctgttccaacacagccggcagcaggagaaggccaaggcggccgcggcccccgcaggaggc
ggcaacgactttgactacccgggcgcccccgtgggccccggaggcgccgtcatgcccggg
gggacgcacggtccccctcccggctacggctgcgcggcggccggctacctggacagcagg
ctggagcctctgtacgagcgggtcggggcgccggcgctgcggccgctggtgatcaagcag
gagccgcgcgaggaggacgaagcgaagcagctggcgctggccggcctctttccctaccag
ccgccgccgccgccgccgccgccgcactcgcacccgccgcccgctcacctggccgccccg
cacctgcagttccagatcgcacactgcggccagaccaccatgcacctgcagcccggccac
cccacgccgccgcccacgcccgtgcccagcccgcacccagcgcccgcgctcggcgccgct
ggcctgccaggccccggcggcgcgctcaaggggctggccgccgcgcaccccgacctccgt
gcgggcggcggcggcggcggcaaagccaagaagtccgtggacaagaacagcaacgaatac
cgggtgcggcgcgagcgcaacaacatcgcggtgcgcaagagccgggacaaggccaagcag
cgcaacgtggagacgcaacagaaggtgctggagctgaccagtgacaatgaccgcctgcgc
aagcgggtggaacaactgagccgcgaactggacacactgcggggcatcttccgtcagctg
cccgagagctccctggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system