KEGG   Capra hircus (goat): 102177814
Entry
102177814         CDS       T02910                                 

Gene name
PTK2, FAK
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04012  ErbB signaling pathway
chx04062  Chemokine signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04670  Leukocyte transendothelial migration
chx04810  Regulation of actin cytoskeleton
chx04935  Growth hormone synthesis, secretion and action
chx05100  Bacterial invasion of epithelial cells
chx05135  Yersinia infection
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05205  Proteoglycans in cancer
chx05222  Small cell lung cancer
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102177814 (PTK2)
   04370 VEGF signaling pathway
    102177814 (PTK2)
   04151 PI3K-Akt signaling pathway
    102177814 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102177814 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102177814 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102177814 (PTK2)
   04062 Chemokine signaling pathway
    102177814 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    102177814 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    102177814 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102177814 (PTK2)
   05202 Transcriptional misregulation in cancer
    102177814 (PTK2)
   05205 Proteoglycans in cancer
    102177814 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102177814 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102177814 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102177814 (PTK2)
   05100 Bacterial invasion of epithelial cells
    102177814 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102177814 (PTK2)
   05163 Human cytomegalovirus infection
    102177814 (PTK2)
   05165 Human papillomavirus infection
    102177814 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102177814 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102177814 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102177814 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102177814 (PTK2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102177814 (PTK2)
Protein kinases [BR:chx01001]
 Non-receptor tyrosine kinases
  FAK family
   102177814 (PTK2)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102177814 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 102177814
NCBI-ProteinID: XP_017914104
LinkDB
Position
14
AA seq 1111 aa
MLLEVVGQGALEPQALSMEKSGCSPFPVCWAKEYDRYLASSKRMAAAYLDPNLNHTPSSS
TKTHLGTGVERSPGTMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKV
KHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQF
TEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVL
EKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKEC
FKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTLQ
LKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKLA
NSEKQGVRTHAVSVSDEISGDETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIEL
GRCIGEGQFGDVHQGTYTSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIV
KLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVH
RDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASD
VWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPS
RRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTASWDSGGSDEAPPKPSRPGYPSPR
SSEGFYPSPQHMVQTNHYQVSGYPGPHGVTAMAGSIYPGQASLLDQTDSWNHRPQEISMW
QPSVEDSAALDLRGLGQALPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSI
DREDGGPQAPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLGSPGDSYNEGVKP
WRLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSSKIQPAPPEEYVPMVKEVGLAL
RTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQML
TAAHALAVDAKNLLDVIDQARLKALGQPRPH
NT seq 3336 nt   +upstreamnt  +downstreamnt
atgttgttggaagtggtgggccaaggggccctggaaccccaggcgctgtctatggagaag
agcggctgtagtccgtttccagtgtgttgggctaaagaatatgacagatacctagcatct
agcaaaagaatggccgctgcgtaccttgacccaaacttgaatcacacgccgagttcaagt
accaagactcacctgggaactggtgtggagcgttctcctgggaccatggagcgagtatta
aaggtctttcattattttgaaagcaacagtgagccaaccacttgggccagtattatcagg
catggagatgcaaccgacgtcaggggcatcattcagaagatagtggacagtcacaaagta
aagcacgtggcctgctatggatttcgcctgagtcacctgcggtcagaggaggttcactgg
ctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcccacccacca
gaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagttt
actgaagacaagccaactttgaatttcttctatcaacaggtgaagagcgattatatgtta
gagatcgctgaccaagtggaccaggacattgcattgaagttgggttgtctagaaatacgg
cggtcatactgggagatgcgtggcaacgccctggaaaagaagtctaactacgaagtgctg
gagaaagatgttggtttgaagcggtttttccctaggagtttactggattcagtcaaggcc
aaaacactaagaaaattgatccaacaaacatttagacagtttgccaatcttaacagagaa
gaaagtattttgaagttctttgagatcctctccccagtgtacagatttgataaagaatgc
ttcaagtgtgcccttggttcaagctggattatttcagtagagctggcgattggccctgag
gaaggaatcagttacctcacagacaagggctgcaatcccacacacctggccgacttcaac
caagtgcagaccatccagtattcaaacagtgaagacaaggacaggaaagggacgctgcag
ctgaagatcgcaggggcacctgagcccctgacggtcacagccccgtccctgaccatcgcc
gagaacatggccgacctgatcgacgggtactgccgcctggtgcacggggccacacagtcc
ttcatcatccggccccagaaagaaggtgaacgggctttgccatcgataccaaagctggcc
aacagtgagaagcagggcgtgcgcacccatgcggtctccgtgtcagatgaaattagtggg
gacgaaacagatgattatgccgagatcatagatgaagaggacacttacaccatgccctcc
aaaagctatggaatagatgaagccagggactatgagattcagagagaaagaatagaactc
ggccggtgcattggagagggccagtttggagacgtgcaccagggcacctacacgagcccg
gagaatccagctttggcggttgcaattaaaacatgtaaaaactgtacttcggacagtgtg
agagagaagttccttcaagaagccttaacgatgcgtcagtttgaccaccctcacattgtg
aagctgatcggagtcatcacagagaacccggtctggatcatcatggagctgtgcacgctc
ggagagctgcggtcgtttctgcaagtaaggaaatacagtttggatctagcgtctttgatc
ctgtatgcctatcagcttagtacagcccttgcgtatctggagagtaaaagatttgtgcac
agggacattgctgctcggaacgttttggtgtcctcaaatgattgcgtaaaattaggagac
tttggattatcccgatacatggaagatagtacttactacaaagcttccaaaggaaaattg
cctattaaatggatggctcctgagtcaatcaattttcgacgttttacctcagctagtgac
gtgtggatgtttggtgtgtgtatgtgggaaatcctaatgcatggcgtgaagccctttcaa
ggcgtgaagaacaatgatgtgatcgggcgcatcgagaacggggagagactgcccatgcct
cccaactgccctcccactctctacagcctcatgaccaagtgctgggcgtacgaccccagc
cggcggccccgcttcactgagctcaaagctcagctcagcacaatcctggaggaagagaag
gtccagcaagaagagcgcatgaggatggagtccagaaggcaggtcactgcatcctgggac
tccggagggtccgatgaagcgccgcccaagcccagcagacctggttatcccagtccgagg
tccagtgaaggattttaccccagcccacagcacatggtacagaccaaccactaccaggtc
tctggctaccctggcccacatggagtcacagccatggctggcagcatctacccaggtcag
gcatctctcttggaccaaacagattcgtggaatcacagaccacaggagatatccatgtgg
cagcccagcgtggaggactcggcggcgctggacctgcgcggcctcgggcaggcgctgccc
acgcacctgatggaggagcggctgatccggcagcagcaggagatggaggaggaccagcgc
tggctggagaaggaggagaggtttctgaaacctgacgtgcggctctctcgaggcagcatc
gacagggaggacggaggtcctcaggccccgactggaaaccagcacatatatcagcctgtg
ggcaaaccagatcctgcagcgccaccaaagaagccaccacgtcccggagcccccgggcac
ctgggcagcctggccagcctcggcagccccggggacagttacaacgagggcgtcaagcca
tggaggcttcagccccaggagatcagcccccctcccactgccaacctggaccggtccaac
gacagggtgtatgagaacgtgacgggcctggtgagagcggtcatcgagatgtccagcaag
atccagcccgccccgccggaggagtacgtccccatggtgaaggaagtcggcctggccctg
aggacgctgttggccacggtggatgagaccattcctgtcctgcccgccagcacccaccga
gagatcgagatggcccagaagctgctgaactccgacctgggggagctcatcaacaagatg
aaactggcccagcagtacgtcatgaccagtctgcagcaggagtacaagaaacagatgctg
acggctgctcacgcgctggccgtggacgccaagaacctgctcgacgtcatcgaccaggcc
agactgaaggccctggggcagccgaggccgcactga

DBGET integrated database retrieval system